KEGG   Halothece sp. PCC 7418: PCC7418_0494Help
Entry
PCC7418_0494      CDS       T02379                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00010  Glycolysis / Gluconeogenesis
hao00052  Galactose metabolism
hao00500  Starch and sucrose metabolism
hao00520  Amino sugar and nucleotide sugar metabolism
hao00521  Streptomycin biosynthesis
hao01100  Metabolic pathways
hao01110  Biosynthesis of secondary metabolites
hao01120  Microbial metabolism in diverse environments
hao01130  Biosynthesis of antibiotics
hao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7418_0494
   00052 Galactose metabolism
    PCC7418_0494
   00500 Starch and sucrose metabolism
    PCC7418_0494
   00520 Amino sugar and nucleotide sugar metabolism
    PCC7418_0494
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PCC7418_0494
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PCC7418_0494
Enzymes [BR:hao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PCC7418_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFZ42723
UniProt: K9Y9H2
Position
complement(548820..549836)
Genome map
AA seq 338 aa AA seqDB search
MTLLIAGDIGGTKTILRLVEVTKQAVDFQTVHQVTYPSQNYSDLVPMVQEFLGETDYTPT
KACFAIAGPVIQQSCQLTNLSWYLEADRLQQELNLEAVSLINDFAAVSYGVLGIKNEELE
PLQGVTPQKDAPIAIIGAGTGLGEGFLIPKGNGDYQIFGTEGGHTDFAARSELEFQILNY
IRQQKQVSRVSVERIVSGQGIISIYQALRDLNIHPEGNASVAETIREWEKQQRTEIDPAA
AIAQAAATDRLCEKTMELFMEAYAAEAGNLALKLLPYGGLYIAGGIAAKNLAWMKSNRFL
KVFKDKGRVSPVLDAVPIHLILDPQVGLIGSIMYGLNQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgactttactcattgctggtgatatcggagggactaaaactatcttacggcttgtggaa
gtcacaaagcaagcagttgattttcaaactgtccaccaagtgacttatccctctcaaaac
tattctgatttagtgccaatggtacaggaatttttaggagaaaccgattatactccgaca
aaagcctgtttcgcgatcgcgggacctgtgatccagcaaagttgtcaactgacaaatctc
agttggtatttggaggcggatcgcctgcaacaggaattaaatcttgaagccgtgagtctg
attaacgactttgcagcagtgagttatggggtcttagggatcaaaaatgaagagttagaa
cccttacaaggggttacgccccaaaaagacgctcccattgccattatcggtgcaggaact
ggcttaggagaaggatttttgattccgaaagggaatggggattatcaaatttttggcaca
gaaggaggacacaccgatttcgcagcgcgatcggagttagaatttcagattttaaactat
attcgccagcaaaaacaggttagtcgggtgtctgtggaaagaattgtctcgggacaaggg
attatctcgatttatcaagccctcagagatcttaatattcatcctgaagggaatgcttcc
gttgcagaaacgatccgtgaatgggaaaagcaacaacggactgagattgatccagcagca
gcgatcgcgcaagcagcagcaaccgatcgcctttgtgaaaaaaccatggaactgtttatg
gaagcctatgcagcagaggcgggaaacctcgccttaaaactactcccttacggcggattg
tatattgcaggaggaattgctgccaaaaacttagcttggatgaaaagcaatcgttttctc
aaagtctttaaggacaaagggagagtcagcccagtgttagatgcagttcccattcatctg
attctcgatccgcaagtcggtctcattggttcgattatgtacggtttaaatcaataa

DBGET integrated database retrieval system