KEGG   Halothece sp. PCC 7418: PCC7418_0532Help
Entry
PCC7418_0532      CDS       T02379                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
hao  Halothece sp. PCC 7418
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PCC7418_0532
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7418_0532
   00620 Pyruvate metabolism
    PCC7418_0532
   00650 Butanoate metabolism
    PCC7418_0532
  Lipid metabolism
   00071 Fatty acid degradation
    PCC7418_0532
  Amino acid metabolism
   00350 Tyrosine metabolism
    PCC7418_0532
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PCC7418_0532
   00626 Naphthalene degradation
    PCC7418_0532
Enzymes [BR:hao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PCC7418_0532
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PCC7418_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(582366..585011)
Genome map
AA seq 881 aa AA seqDB search
MTVTNLQELENLISQVKAAQAQYATYTQDQVDAIFKKAALAANMNRIPLAKMAVQETGMG
VQEDKVIKNHFASEMIYNKYKHEKTCGIIESDPHYGMQKIAEPIGVLAGIVPTTNPTSTA
IFKALLALKTRNGIIFSPHPRAKQCTIDAAKIVRDAALEAGAPPNIIGWIDEPTIELSQT
LMQHPSVNLILATGGPGMVKAAYSSGKPSLGVGAGNTPAVIDETANIPMAVSSILISKTF
DNGMICASEQSVIVVDDVYEKVREEFIARGAYILNEEEREAVRKVLIVDGRINAKIVGQS
VDTIAEMAGIEGAKGKKVLIGEVEDISLEEPFAYEKLSPVLAMYHAQDFEEATKKGQQLI
SLGGRGHTSVLYTAQQNHSRILHFESILTTGRVLINTPSSQGAIGDLYNFKLDPSLTLGC
GTWGGNSVSENVAAHHLLNIKTVSERRENMLWFRVPPKIYFKFGCLPIALQELKGKERAF
IVTDKPLFDMGLLKEVTEVLDDIGVEHQVYYDVQPDPKLAEINKGVEAMNQFQPDVIISF
GGGSPMDAAKIMWLLYEHPEVEFEGVATRFMDIRKRVYDLPPLGEKAMMIAVPTTSGTGS
EVTPFAVVTDEKTGMKYPLADYALTPNMAIVDPELVMNMPKRLTAYGGIDALTHALEAYV
SVVATEFTQGLALEAVELLFKYLPNAYKYGANDPVAREKVHYAATIAGMAFANSFLGICH
SMAHKLGATFHVPHGLANALMIAHVIRYNTTDAPFKQTIFPQYEYPHAKERYARLADYLK
LGGETLDDKVENLVSAIENLKQNLDIPLTIKETLQGEDREFYEKLENLAEQAFDDQCTAA
NPRYPLIKDLKELYVLAYQGCRVDSMMYHTEEEDSTADSMA
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaccaacctccaagaactcgaaaatctgatttcccaagtgaaagcagcccaa
gcgcaatatgccacttacacccaagaccaagtggatgctatctttaagaaagcagcgtta
gctgccaatatgaatcgcattccattagcaaaaatggcggttcaagaaacgggaatgggg
gtgcaagaagacaaggtgatcaaaaatcactttgcttcggaaatgatttataacaaatat
aaacatgagaaaacctgtgggatcattgaatctgatcctcactatgggatgcaaaaaata
gcagaaccgattggagttttagcaggaattgttcctacgactaatcccacttctacggca
atttttaaggctctactggcgctgaaaactcgcaatggcatcattttttctcctcaccct
cgcgcgaaacaatgcaccattgatgcagcgaaaattgtgcgcgatgcagccctagaagcg
ggtgcgccccctaatattattggttggattgatgaaccgaccattgaactgtctcaaact
ttaatgcagcatcccagtgtgaatttaattctcgccacagggggaccgggaatggtaaaa
gctgcttattcttctggtaagccatctttaggcgttggtgcgggaaatacccctgctgtc
attgatgaaaccgcaaatattcccatggcggtgagttcaattttaattagtaaaactttt
gataatgggatgatttgcgcctcagaacaatcggtgattgtggtggatgatgtctatgaa
aaagtgagagaagaattcattgctcgtggggcttatattctcaatgaagaggaacgagaa
gcggttcgtaaagtcttaattgttgatggacggattaatgctaaaattgtcggtcaatcc
gtcgatacaattgcggaaatggcaggaattgaaggggcaaaagggaaaaaagttttaatt
ggagaagtggaggatatcagtttagaagaaccctttgcttatgaaaaattgtctcctgtt
ttagcgatgtatcatgcccaagactttgaagaggcaacgaaaaagggacaacaattaatt
agtttagggggacggggacatacatcagttctttatactgctcaacaaaatcattctcga
attttgcattttgaaagcattctcaccacaggacgggtgttaattaatacgccttcttct
cagggcgcgatcggcgatttgtataactttaaactcgatccgtcattaaccttgggttgt
ggtacttggggtggtaattctgtcagtgaaaatgttgctgcccatcaccttttaaacatt
aaaacggtttctgagcgacgggaaaatatgttatggttccgtgtgccaccgaaaatctat
ttcaagtttggttgtttaccgatcgcgctgcaagaattaaaaggaaaagaacgggcgttt
attgtcacggataaacctttatttgatatggggttactgaaagaagtgactgaggtttta
gatgatattggtgtcgaacatcaagtttattatgatgttcaacctgatcccaagctcgcg
gaaattaacaaaggcgtggaggcgatgaatcaattccagcctgatgttattatttccttt
ggtggcggttcgcccatggatgcagccaaaattatgtggttgctatacgaacatccagaa
gtggagtttgaaggggttgctacccgctttatggatattcggaaacgggtctatgactta
ccgccattaggggaaaaagcgatgatgattgcggttccgacaacctcgggaacgggttct
gaggtcacgccgtttgctgtggtaaccgatgagaaaacgggaatgaagtatcctcttgcg
gattacgccctcacgccaaatatggcaattgttgaccccgagttggtgatgaatatgcca
aaacggttaaccgcttacgggggaattgatgctttaacccatgccttagaagcctatgtt
tcggtggtggcgacagagtttacccaagggctagctttagaagcagtagaattgctgttt
aagtatctccccaatgcctataaatatggggcaaatgaccccgtggcgcgggaaaaagtc
cattatgcagcaacgatcgcgggaatggcgtttgccaactctttcttaggaatttgtcac
tctatggcgcacaaattaggggcgaccttccatgtgcctcacggtttagccaacgcgctg
atgattgctcatgtcatccgttataacacgacggatgcaccgtttaagcagacgattttc
ccccaatatgaatatcctcatgccaaagaacggtatgcgcggttagcggattatcttaaa
ctgggtggggagacgctcgatgataaagtggaaaacttagtcagcgcgatcgaaaatctc
aaacaaaatcttgatattcctctgaccattaaagaaaccctgcaaggggaagatcgagaa
ttttatgagaagctggaaaatcttgctgaacaagcctttgatgaccaatgcaccgcagct
aatccccgttatcccctgattaaagacttgaaagagttgtatgttttggcgtatcaaggc
tgtcgcgtggatagcatgatgtatcataccgaagaagaagatagcacagcagattctatg
gcataa

DBGET integrated database retrieval system