KEGG   Halothece sp. PCC 7418: PCC7418_0827Help
Entry
PCC7418_0827      CDS       T02379                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hao  Halothece sp. PCC 7418
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PCC7418_0827
Enzymes [BR:hao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PCC7418_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(901583..902539)
Genome map
AA seq 318 aa AA seqDB search
MNQSHIVVFGSLNMDLLAKTSRLPLAGETITGDKFQMIPGGKGANQAIAVSRLGIPCRMV
GRVGKDSFGETLLQSLQDNDVDTTGVLVEESAHTGVAMITVNEQGENQIIVIPEANGNLD
ESDVERLRPHLEGAQFLLMQLEIPIAVVGAAAELARSLGIKVILDPAPAQELPFPLYSNI
DIITPNALEAEILVGFPVTDTDSAQQAATQLQSQGVNTVMITLGKQGVYCAHGEESFFVP
AFDIEPIIDTVAAGDAFNGGLAVALCGGMNLQRSIICGSAAGALTVTKAGAQSALPNYER
LYKFLGERVGWKPDLELL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtctcatattgttgtcttcggtagtctgaatatggatctcttagctaaaacc
tcccgtttacctttagcaggagaaacgattactggagacaagtttcagatgattccaggg
ggaaaaggggcaaatcaggcgatcgcggtgtctcgcttagggattccgtgtcggatggtg
gggcgtgtgggaaaagatagctttggtgaaacgctccttcaatccttacaagacaatgac
gttgatacgacaggggttttagttgaagaatccgctcacactggcgttgcgatgattaca
gtcaatgagcagggagaaaatcaaattattgtcattccagaagcgaatggaaacttagat
gaatcggatgtggaacggttgcgcccgcacttagaaggagcccaatttttattaatgcag
ttagaaattcccattgcggtagttggggctgctgcagagttagcgcgatcgctgggtatt
aaagtgattttagatcccgcccctgctcaagaattgcccttccccctgtatagcaatatt
gatattattacccccaacgccctagaagcagaaatactagtgggttttcctgttaccgat
accgactccgcccaacaagctgcaactcaattacaaagtcaaggcgttaacacagtcatg
attaccttggggaaacaaggagtatattgcgctcacggagaagagagcttttttgttccc
gcctttgatatcgaaccgattattgacactgttgctgctggggatgcgtttaatggcggt
ttagcggtcgccttatgtggtggaatgaatctccaacgatcaattatttgcggttcggct
gcgggggctttaaccgtaacgaaagcaggggcgcaatcggcattacccaattatgaaaga
ttatataaatttttaggggagcgtgtcggctggaaaccagatttagaactgctatag

DBGET integrated database retrieval system