KEGG   Halothece sp. PCC 7418: PCC7418_0928Help
Entry
PCC7418_0928      CDS       T02379                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hao  Halothece sp. PCC 7418
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC7418_0928
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7418_0928
   00052 Galactose metabolism
    PCC7418_0928
   00500 Starch and sucrose metabolism
    PCC7418_0928
   00520 Amino sugar and nucleotide sugar metabolism
    PCC7418_0928
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PCC7418_0928
   00524 Butirosin and neomycin biosynthesis
    PCC7418_0928
Enzymes [BR:hao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PCC7418_0928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1010853..1011746)
Genome map
AA seq 297 aa AA seqDB search
MQQPTVIGIDLGGTAIKLGQFLQNGTCLQQTTLPTPQPPDPEAVTDFLRVAIQELDPKQT
SCAIGIGTPGPTDATGRIALIAINLAGWRDVPLADLLENKIGLPTFVANDANCAGLGESW
LGAGRHVNNLILLTLGTGVGGAIILDQQLFTGPYGAAGELGLITLNPYGDHCNSGNHGSL
EQHLCVQAIQRKTQKTPAELGKLAAAGDQTALAFWEDYGRDLGAGLASLIYVLTPEAIII
GGGISASAAFFLPAAQQEIEQRVVGISRMNLQLLTAQLGNQAGMVGAAKLAWEKNQF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacagcccacggttattggcatcgacttaggcggaaccgcaattaaactgggacaa
tttttgcaaaatggcacttgtctccaacagaccaccttaccgactccgcaaccccctgat
ccagaagcagtgaccgacttcctgcgggttgctattcaagaacttgatcccaaacaaacc
agttgcgcgatcggtattggcacaccaggtcctactgatgccacaggaagaattgctctg
attgcgattaatcttgcaggttggcgcgatgttcctttagcagatctgttagagaacaaa
attggactcccgacgtttgtcgccaatgatgcgaactgtgcaggcttaggggaatcttgg
ctgggggcgggtcgccatgtcaataatttaatcttactgactcttgggacaggggttggc
ggtgcaattattcttgatcagcaactatttacggggccttatggggctgcgggagagtta
gggttaattaccctcaatccttacggcgatcactgcaatagtggcaatcatggctctctg
gaacaacatttatgcgtgcaagccattcaacggaaaacgcaaaaaacgcctgctgagtta
gggaaacttgcagcagcaggggatcaaaccgcccttgccttttgggaagactatggccgt
gatttaggggcaggattagccagtttaatttatgttttgaccccagaagccattattatc
ggtgggggaattagtgccagtgcagccttctttttacccgcagcacagcaagaaattgaa
cagcgtgtggttggcatttcacggatgaatttacaactgttaacagcacaattgggcaat
caagcgggaatggtgggggctgctaaactcgcttgggaaaagaatcaattctga

DBGET integrated database retrieval system