KEGG   Halothece sp. PCC 7418: PCC7418_1008Help
Entry
PCC7418_1008      CDS       T02379                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hao  Halothece sp. PCC 7418
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:hao02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:hao02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097676..1098809
Genome map
AA seq 377 aa AA seqDB search
MSLLYEGLMTNDKGLIITKMTIHVLLVEDSPIATMIIKRIIDNSSGLSVVGTAKNGVEGL
ELIPKLNPDIICTDLHMPKMDGLAFTQEVMAEFPRPILVISASVQEDDPQNVFKLLEAGA
LEVFPKPRAGLSQEYEALQAELVRKIRVLSGVKVFRRKRKTHSPAPVAPKTTSSASPVVT
AKTSKTSAIKAVVIGSSTGGPQALHTIFQSLPAAFPVPIICVQHISLGFLQGLVDWLKNH
CSLKVEIAKEKDFPKAGVIYFPPENQHLKLDRQGRFVYDQSLPVTGHRPSVDVLFESASA
YYRSQMVGVLLTGMGRDGANGLQTIRKAGGMTIAQDEATSIVFGMPKEAIALGAVQHTLP
IDQIASKVLTLLSLCPF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctctactctacgaaggactaatgaccaatgacaaaggactaataataaccaaaatg
acaattcatgtgttgctcgttgaagattctcccattgccaccatgattataaaacgaatt
attgataatagctctggtctgtcagtggtgggaacagctaaaaatggggtagaaggatta
gaattaatcccgaaactgaatcctgatattatctgtaccgatttacacatgcccaaaatg
gacgggctagcctttactcaagaagtaatggcagaatttccacgtccgatcctcgtgatt
agtgcttccgtgcaagaagatgatccacaaaatgttttcaaacttctagaagcgggtgcg
ctagaagtcttccctaaacctcgcgcggggttatcgcaagaatatgaagccctccaagcc
gagttagtgagaaaaattcgagttttgtctggggtgaaagtgtttcggcggaaacgaaaa
actcattctcccgcacccgttgctccaaaaactacatcctcagcgagtcctgttgttact
gctaaaacgagtaaaacctctgcgatcaaagccgtggttattggctcttctacaggggga
ccgcaagcactacataccatttttcagagcttaccggctgctttccctgttcccattatt
tgtgttcaacatattagtttaggctttctacaagggttagttgattggctgaagaatcat
tgttccctgaaagtcgaaattgccaaagaaaaagactttccgaaagcaggagtgatctat
tttcccccagaaaatcaacatctcaagctcgatcgccaaggacgatttgtttatgatcaa
tctttacccgtgacagggcatcgtccctctgtagatgttctgtttgagagtgcatccgcc
tactatcgctcgcaaatggtaggagttttgttaacgggaatgggacgagatggcgcaaat
ggactgcaaacgattcgtaaagcgggaggaatgacgatcgcgcaagatgaagccaccagt
attgtctttggtatgccaaaagaagcgatcgcgctgggtgcagtacagcataccttaccc
attgatcaaattgcgagtaaagtgttgacactgcttagtctgtgtccgttctga

DBGET integrated database retrieval system