KEGG   Halothece sp. PCC 7418: PCC7418_1119Help
Entry
PCC7418_1119      CDS       T02379                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00010  Glycolysis / Gluconeogenesis
hao00020  Citrate cycle (TCA cycle)
hao00620  Pyruvate metabolism
hao01100  Metabolic pathways
hao01110  Biosynthesis of secondary metabolites
hao01120  Microbial metabolism in diverse environments
hao01130  Biosynthesis of antibiotics
hao01200  Carbon metabolism
Module
hao_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7418_1119
   00020 Citrate cycle (TCA cycle)
    PCC7418_1119
   00620 Pyruvate metabolism
    PCC7418_1119
Enzymes [BR:hao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PCC7418_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFZ43325
UniProt: K9YAA3
Position
complement(1220623..1221909)
Genome map
AA seq 428 aa AA seqDB search
MIRDIFMPALSSTMTEGKIVSWAKSPGDKVEKGETVLVVESDKADMDVESFHDGYLATIL
VQEGEQAPVGSAIGLLAETEAEIETAKQQAQSKQTASTPAETKTPEPAAPAPSKPEPAAP
AVQPAPAAKKENGRVIASPRARKLAQEHNIDLATLQGSGPHGRIVAADVEAATGQAPATP
TPQAAPQPTPQPAPQPTPQPAPAGKGEVVPFTTLQSSVVRNMTATVQVPTFHVGYTITTD
ELDKLYQQIKSKGVTMTALLAKAVASTLQKHPLVNASYTDQGTQYNSAINIAVAVAMEDG
GLITPVLRNAAEQDIYTLSRNWKDLVKRSRSKQLQPEEYSTGTFTLSNLGMFGVDRFDAI
LPPGQGGILAIGASRPQVVATDDGLFGVRRQMSVNITCDHRIIYGAHAAAFLQDLAQLIE
NDPQSLTL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgacattttcatgcctgccctcagttcaaccatgaccgaaggaaaaattgtt
tcttgggcaaaatcccctggtgataaggtggagaaaggggaaaccgtcctcgtagtggaa
tcagacaaagctgatatggatgtggagtcgttccatgatgggtacttagcaaccattctc
gtccaagaaggagaacaagcccctgttggttcagcaattggtttactcgctgaaactgaa
gcagaaatcgaaacggcaaaacaacaagcccaaagcaaacaaaccgccagcactccagca
gaaaccaaaacccctgaacctgctgcacctgctccttcaaaacctgaacccgcagcacca
gcggtacaacctgcccctgctgcgaaaaaagaaaatggtcgggtgattgcttctcctcgc
gcccgtaagttagcccaagaacacaacattgatttagcaacgttacaagggagtggcccc
cacggtcgaatcgtagcagcagatgtggaagcagcaacgggtcaagcacccgcgacaccg
actcctcaagctgcccctcaacccacgcctcagcctgccccgcaacccacaccacaacct
gcacctgctgggaaaggagaagtggttccctttactaccttacaaagttctgttgttcgt
aacatgacggcaacggtacaagttcctacgttccatgttggttacaccatcaccaccgat
gaactcgataaactctatcaacaaatcaagtcgaaaggggtaacaatgactgctctcttg
gcgaaagcggtggcgagcactctccagaaacatcctttagtcaatgctagttatacggat
caaggaacacaatataactcggcgattaatattgcggttgcagtcgcgatggaagatggt
ggtttgattacccctgtcttacgcaatgctgcggaacaagatatttataccctctctcgc
aactggaaagatttagttaaacgatcgcgcagtaaacaactacaacccgaagaatatagc
acgggtacctttaccctttccaacttaggaatgtttggggtcgatcgctttgatgcgatt
ttaccgcctggacaaggcggaattcttgccattggcgcatctcgtccgcaagtggtcgcc
actgatgacggactgtttggggtgcgtcgtcagatgagcgtgaatatcacctgcgaccac
cgcatcatttatggcgctcatgctgctgctttcttacaagatttagcgcagttgattgaa
aatgatccacaatccttaaccctttaa

DBGET integrated database retrieval system