KEGG   Halothece sp. PCC 7418: PCC7418_1471Help
Entry
PCC7418_1471      CDS       T02379                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hao  Halothece sp. PCC 7418
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PCC7418_1471
Enzymes [BR:hao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PCC7418_1471
Exosome [BR:hao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC7418_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1614608..1616119)
Genome map
AA seq 503 aa AA seqDB search
METKQKYVLALDLGTTGNRAILFDGNGEVVGQSYGELTQYYPHPGWLEHDPMEIWHDTRS
CMEQVFRSTGVSPQGVAAAGLTVQRETCLLWNKTTGEPLHKAIVWQDRRTAHNCRELTEK
GYAEKIQESTGLVLDAYFSASKLAWLLDWVKQNQPEVDLDKVLAGTVDTWILWNLTGRRV
HGTDHSNASRTMLMNLGTDEWDSELLDLFGIPAHLMPEIRPSLGDFGVIDEEILGTEIPI
RAVFGDQQAALFAHGCNQKGMLKCTYGTGSFLIAQSGQELTRSRNQLLSTVAWSEANGGK
PVTNYALEGAMFTTGACIQWLRDGLKLIKSAPETDTLARSVNDTDGVYFVPALSGLGAPH
WDMSARGGFLGITGGVQREHIVRAVLESIAYQVKEVVDAMNQDGDTPISLLKVDGGASQN
NFLMEFQADVLGIPVERPAILDATAQGAAFGAGLAIGFWNDYDELVAKRKRDRSFIPSKN
QHQAQDNFQMWQKAVGRAKNWTE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtggaaactaagcaaaaatacgttcttgccctcgacttaggaacaactggaaatcgtgcc
attctctttgatgggaatggggaagtggtcggacaatcttatggggaattgactcaatat
tatcctcatcctggttggctcgaacatgatccgatggaaatttggcatgatactcgtagc
tgtatggaacaggtttttagaagtacgggagtgtctccccaaggggtcgcagcagcaggg
ttaacggtacaacgagaaacttgtttactctggaataaaacaacaggagaaccgttacat
aaagcaattgtttggcaagatcggcgaacggctcacaactgtcgagaattaacggaaaaa
ggctatgcggaaaaaatccaagaaagtacaggtttagttttagatgcttatttttccgcc
agtaagttggcgtggttacttgattgggtgaaacagaatcagccagaagtggatttagat
aaggtgttagcggggacggttgacacttggattctttggaatttaacgggaagacgagtt
catggtacagaccatagtaacgccagtcggacgatgttgatgaatttggggacagatgag
tgggattcggagttattagacttatttggcattccagcccatttaatgcccgaaattcgt
ccaagtttaggagattttggcgtaattgatgaagagattttagggacagaaattccgatt
cgcgctgtgtttggcgaccaacaagcagccctcttcgctcacggttgtaatcaaaaagga
atgctgaaatgtacttatgggacaggctctttcttaattgctcagagtggacaagagcta
acgcgatcgcgcaatcaactcctctccactgtcgcctggagtgaagccaatggcggaaaa
cctgtcacgaactacgctttagaaggggcgatgtttaccacaggggcttgtattcagtgg
ctgcgcgatggactgaaactgattaaatccgcaccagaaacggatactttagcccgtagt
gtcaatgatactgatggggtttactttgttccagcgttgagtggtttgggtgcgcctcac
tgggatatgagcgccagaggtggttttttagggattacaggcggtgtgcagcgtgaacat
atcgtcagagcggttttagagtccattgcttaccaagtcaaagaagttgtggatgcgatg
aatcaagatggcgataccccaatctctcttctcaaggtggatgggggggcttcccaaaat
aatttcttgatggagtttcaagcggatgtgttggggattcctgtggagcgtcctgcgatt
ttagatgcaacggcgcaaggggctgcatttggggcgggtctagccattggtttctggaat
gattatgatgaattagtcgccaaacggaagcgcgatcgtagctttattcccagtaaaaac
caacatcaagcccaagataacttccaaatgtggcaaaaagcagtaggacgagccaaaaac
tggacagaataa

DBGET integrated database retrieval system