KEGG   Halothece sp. PCC 7418: PCC7418_1478Help
Entry
PCC7418_1478      CDS       T02379                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
hao  Halothece sp. PCC 7418
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PCC7418_1478
Enzymes [BR:hao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PCC7418_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1623357..1623917
Genome map
AA seq 186 aa AA seqDB search
MKLYYLPLTRASRPHWLLEELEISYELIQVTPDEMSEKPEYKGLHPHGKIPVLVDDNITI
HESAGICAYLADQYPDKQLAPSLMSPARGYYYQWLFYAAVTLEPPVERYLFHVFPHLSEK
VLPDSEYENLSKDETLHWFGKVCQPLNDHLKENQYLVENQFTAADVITGGVLFWAFKIGL
LKKKPP
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttattatcttccgttaacccgagccagtcgccctcattggctattagaagaa
ctggaaatttcctatgaattaattcaagtgacccctgatgaaatgtcggagaaaccagaa
tataaaggactccatcctcatggtaagattccagttttagttgatgataatatcacaatt
catgaatctgctggaatttgtgcttatttagccgatcaatatcctgataaacaacttgct
ccctctcttatgagtcccgcaagaggctattattatcaatggttgttttatgctgcggtg
acgttagaacctcctgtggaacgatatctttttcatgttttccctcatttgtcagagaaa
gtattacctgatagtgaatatgaaaacctttctaaggacgaaacattacactggtttgga
aaagtctgtcaacccctcaatgaccacttaaaagagaatcaatatctcgttgaaaatcaa
tttacggctgctgatgttattacaggtggtgttttgttttgggcgttcaaaataggatta
ctaaaaaagaaacccccgtga

DBGET integrated database retrieval system