KEGG   Halothece sp. PCC 7418: PCC7418_1909Help
Entry
PCC7418_1909      CDS       T02379                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hao  Halothece sp. PCC 7418
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC7418_1909
Enzymes [BR:hao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PCC7418_1909
Exosome [BR:hao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC7418_1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2095114..2097414
Genome map
AA seq 766 aa AA seqDB search
MSQNLTPEQVQQIVSHQHPNPFQVLGAHLIETDDQQQKWAIRAYVPHAEAVWVRLPAARE
EHPMQTQHHPQFFECILDLDGKPLINYQLRIQEKERERVIYDPYAFPSPLLTEYDRYLFS
EGNHHRIYEKLGAHPTTVKGVTGVYFATWAPNAQSIAIVGDFNDWEKGQHPMQKGENGIW
ELFIPGVEVGQCYKYIITGKNGEIEDKSDPYGFQQEVRPHTASIVTDLDTYTWGDSAWLE
KRRHRDPLQSPISVYEVHLGSWLQGSVHDPPRSLQGNVSPVTMSAENQEARFLTYYELAE
TLIPYVKELGYTHIELLPLAEHPFDGSWGYQVTAYYACTSRYGPPQDLMYFVDQCHQNGI
GVILDWVPGHFSKDIHGLALFDGTHLYEHPDPRRGEHKEWGTYVFNYARPEVKNFLVANA
LFWLDKYHLDGLRVDAVASMLYLDYQRQEGEWLPNEFGGRENLDAVAFLRQTNYLLFSYF
PGVVSIAEESTAWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNLTFS
MWYHHSENYMLALSHDEVVHGKSHILGKMPGDEWQKFANVRCLFAFMFTHPGKKTLFASM
EFGQWNEWDETTPLDWWLLEYPLHSRLKQYVGDLNNLYRQQPALYEQDFMDEGFSWIDCN
DHRHSVISFIRRAQDPSDFLLVVCNFTPQPHSHYRVGVPTAGFYQEIFNSDSREYGGSNM
GNLGGKWTEEWTFHEQPYSLDLCLPPLAVTIFKLDAEKTRETDSSR
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaatttgaccccagaacaagtccaacaaattgtctctcatcaacatcccaac
ccctttcaagttcttggggcgcatttgatcgaaaccgacgaccagcagcaaaaatgggca
attcgcgcttatgttccccatgcagaagccgtgtgggtgcgtttacccgcagcgagagaa
gaacacccgatgcaaactcagcatcaccctcaattttttgagtgcatccttgatttagat
ggaaaacctctgattaattatcaactccgcatccaagaaaaagaacgggaacgggtgatt
tatgatccttatgcgtttccgtcccctcttctgactgaatatgaccgctatctcttttca
gaaggcaatcatcaccgcatttacgaaaaactgggagcgcatcccacaaccgttaaggga
gtcacaggggtttattttgctacatgggctccaaacgcgcaaagcattgctattgttggc
gattttaacgactgggaaaaaggacaacatcccatgcaaaaaggagaaaatgggatttgg
gaactgtttattcctggtgtagaagtgggacaatgctataaatatattattacggggaaa
aacggagaaattgaagataaatccgatccttatggctttcagcaagaagtacgcccccat
accgcttccattgtcactgatttagatacttatacatggggagatagtgcttggttagaa
aaacgccgtcatcgtgatcccttacagtctcccatttcggtttatgaagtccatttagga
tcttggttacaagggtcagtgcatgatccaccgcgcagtttacaagggaacgtttctccc
gtaaccatgtcggcggaaaatcaagaagcaaggtttctgacttattacgaacttgcggaa
acgctcattccctatgtgaaagaattaggttatacccatattgaactgcttccgctggct
gaacatccctttgatggatcttggggttatcaagtcaccgcttattatgcttgcacctct
cgctatggcccccctcaagacttaatgtattttgtcgatcaatgtcatcaaaacggcatt
ggggtcattctcgattgggtacctggacacttttctaaagatatccacggcttagcccta
ttcgatggcacgcatctttatgaacatcctgatccgcgacgaggagaacataaagagtgg
ggaacctatgttttcaattatgcccgtcctgaagttaaaaattttctagtcgccaatgct
ctcttctggctcgataaatatcatctggatggcttacgggtggatgcagttgcatcaatg
ctctatcttgattatcaacgacaagagggagaatggttacccaatgagtttgggggaaga
gaaaacctagatgcggtcgcatttctccgccaaaccaattatttactctttagttacttc
cctggggttgtctccattgcggaagagtccaccgcttggccaatggtgtcttggcccact
tatacgggcggtttaggctttaacctgaaatggaatatgggctggatgcacgatatgctc
gattatttcagtatggatccctggttccgccagtttcatcaaaataatttaacgtttagt
atgtggtatcaccacagcgagaattatatgctggcgttatctcatgatgaggtggtacat
gggaaaagccatattttagggaaaatgccaggggatgaatggcaaaagtttgcgaatgtg
cgctgtttatttgcctttatgtttacccaccctggaaagaaaactttatttgcttccatg
gagtttggacaatggaatgagtgggatgaaaccaccccgttagattggtggctgttagag
tatcctttacattctcgtcttaaacaatatgtgggagacttaaataatctttatcgccaa
caacctgcgttatacgaacaagattttatggatgagggttttagttggattgactgtaat
gatcatcgccatagcgtgatctcctttattcgtcgcgcccaagatccgtccgactttttg
ctggttgtttgcaattttaccccccaaccccacagtcactaccgagtgggtgttcccacc
gcaggcttctatcaagaaatttttaattctgatagtcgcgagtatggggggagtaatatg
ggaaacttgggggggaaatggacagaagaatggacgtttcatgaacagccctattccctc
gatttatgcttaccgcctttagcggtgactatatttaagttagatgcggagaaaacgagg
gaaactgactcgtctcgttag

DBGET integrated database retrieval system