KEGG   Halothece sp. PCC 7418: PCC7418_2043Help
Entry
PCC7418_2043      CDS       T02379                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hao  Halothece sp. PCC 7418
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCC7418_2043
Enzymes [BR:hao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PCC7418_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2246751..2247419
Genome map
AA seq 222 aa AA seqDB search
MSNGSVKKVTNQVSLDTASSVEAAVTKDNTQEPQMQEMMGAVRTLLQGVGEDPEREGLLK
TPKRVAEAMQFLTQGYEQSLEELVNGAIFDEGHNEMVLVRDIDVFSLCEHHMLPFMGKAH
VAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAIQTILDPQGVAVVMEATHMCM
VMRGVQKPGSWTVTSAMLGVFQEDHKTREEFLNLIRHQPSFH
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacggttcagtgaaaaaagtaaccaatcaagtgtctctcgatactgcttcctcg
gttgaagcagcagtgaccaaagacaacactcaagagccccaaatgcaagaaatgatgggc
gcggtgagaacgctattgcagggggtaggagaagatcccgaacgagaagggctactaaaa
acgcctaaacgagtcgctgaagcgatgcagtttctgacccaagggtatgaacagtctctt
gaggagcttgtgaatggtgctatttttgacgaaggacacaatgaaatggtgctggtgagg
gacattgatgtgtttagtctgtgtgagcatcatatgttaccgtttatgggcaaagctcat
gttgcctatatccccaatcagaaggtagtggggttaagtaaactcgctcgcattgtggaa
atgtattctcggcgtttgcaagtgcaagaacgtctcacccgtcaaattgccgaagcgatt
cagaccattcttgatccgcaaggggttgctgttgtgatggaagcaacccatatgtgtatg
gttatgcgaggagtacaaaagcctggctcttggacagtcaccagtgcgatgttaggggtc
tttcaagaagatcataaaactcgtgaggagtttcttaacttgattcgccatcaaccgagc
tttcattaa

DBGET integrated database retrieval system