KEGG   Halothece sp. PCC 7418: PCC7418_2121Help
Entry
PCC7418_2121      CDS       T02379                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hao  Halothece sp. PCC 7418
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hao01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hao00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2344294..2345595
Genome map
AA seq 433 aa AA seqDB search
MLRIINQVAEATTELQRISRRTHDQQIAGKEEAVQEIIQTVRKKGDQALLDYTAKFDQLT
LTVDQLRVSGSELDAAYQQVSKELIDAIALARQQIEAFHRQRTPKSWVEFGNQTVLGKRY
TPVDRAGLYVPGGRAAYPSTVLMNAVPAKVAGVERRVMVTPPGADGKITPAVLVAAQEAG
IEEIYRIGGAHAIAALAYGTERIPEVDVITGPGNLYVTLAKKMVYGTVGIDSLAGPSEVL
VIADQNANPVYVAADLLAQAEHDPMAAAILLTTEEKLAQQVQEEVQKQLADHPRRTLTEK
SIANYGVVIIVNSLKEAAELSNIFAPEHLELEVEDPWEMLHLIRHAGAIFMGHSTPEAVG
DYLAGPNHTLPTSGAARYASALGVETFMKHSSLIEYSQTALDHVSQAIQTLAEAEGLHSH
SESVRLRRENNQE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggatcatcaatcaagtcgcggaagcaacaacagaacttcagagaatttctcgc
cgaactcacgatcaacaaatcgcggggaaagaagaggcggtgcaagaaattattcaaacg
gtgaggaaaaaaggggatcaagccctgcttgattacacggcaaaatttgatcagctgacc
ttaacggttgatcaattacgggtgagtggatcagaactggatgctgcttatcagcaagta
tctaaggaactcattgacgcgatcgcgctggcaagacaacaaattgaagcctttcatcgt
caacgaaccccgaaatcttgggtcgaatttggcaatcaaaccgtcttaggtaaacgttat
acccctgttgatcgcgcagggttatatgttccaggcggacgagcagcttatcctagtaca
gtcttgatgaatgcggttccggcaaaagtagcaggtgtcgagcgacgggtgatggtaaca
cccccgggtgctgacggtaaaattactcctgcggtattagttgcagcacaagaggctgga
attgaagagatttatcggatcggaggggcgcacgcgatcgcagccttagcctatggaaca
gaaaggattccagaagtggatgtgattacagggccaggcaatctctatgtcactcttgcg
aaaaagatggtttatggcacagtgggcattgattctctggcgggtccctcggaagtgttg
gtgattgcggatcagaatgcaaatccagtttacgttgctgctgatttgttagcccaagcc
gaacatgatccgatggcagcagcaatcttgttaacaacagaagagaaactcgcacagcaa
gtgcaggaggaagtgcaaaaacaattagccgatcatcctcgtcgcactttaacagaaaaa
tcgatcgcgaattatggtgtggtcattattgttaactcccttaaggaagcagcagaatta
tctaatattttcgcccccgaacatttagagttagaagtggaagacccctgggaaatgttg
catctgatccgccatgcaggggcgatttttatgggacattcgactccagaagcggtaggg
gattatctcgccggtcccaatcataccttacccacgtctggggctgctcgttatgcgtct
gcgttgggggtagaaacgtttatgaagcattccagcttaattgaatattcccagactgct
ttagatcatgtttcccaagccattcaaaccttagcggaagcagaaggattgcattctcac
agtgaatccgtccgtttacgcagggaaaacaatcaagagtaa

DBGET integrated database retrieval system