KEGG   Halothece sp. PCC 7418: PCC7418_2121Help
Entry
PCC7418_2121      CDS       T02379                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00340  Histidine metabolism
hao01100  Metabolic pathways
hao01110  Biosynthesis of secondary metabolites
hao01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PCC7418_2121
Enzymes [BR:hao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PCC7418_2121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Cytidylate_kin RRF_GI
Motif
Other DBs
NCBI-ProteinID: AFZ44283
UniProt: K9YDY1
Position
2344294..2345595
Genome map
AA seq 433 aa AA seqDB search
MLRIINQVAEATTELQRISRRTHDQQIAGKEEAVQEIIQTVRKKGDQALLDYTAKFDQLT
LTVDQLRVSGSELDAAYQQVSKELIDAIALARQQIEAFHRQRTPKSWVEFGNQTVLGKRY
TPVDRAGLYVPGGRAAYPSTVLMNAVPAKVAGVERRVMVTPPGADGKITPAVLVAAQEAG
IEEIYRIGGAHAIAALAYGTERIPEVDVITGPGNLYVTLAKKMVYGTVGIDSLAGPSEVL
VIADQNANPVYVAADLLAQAEHDPMAAAILLTTEEKLAQQVQEEVQKQLADHPRRTLTEK
SIANYGVVIIVNSLKEAAELSNIFAPEHLELEVEDPWEMLHLIRHAGAIFMGHSTPEAVG
DYLAGPNHTLPTSGAARYASALGVETFMKHSSLIEYSQTALDHVSQAIQTLAEAEGLHSH
SESVRLRRENNQE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggatcatcaatcaagtcgcggaagcaacaacagaacttcagagaatttctcgc
cgaactcacgatcaacaaatcgcggggaaagaagaggcggtgcaagaaattattcaaacg
gtgaggaaaaaaggggatcaagccctgcttgattacacggcaaaatttgatcagctgacc
ttaacggttgatcaattacgggtgagtggatcagaactggatgctgcttatcagcaagta
tctaaggaactcattgacgcgatcgcgctggcaagacaacaaattgaagcctttcatcgt
caacgaaccccgaaatcttgggtcgaatttggcaatcaaaccgtcttaggtaaacgttat
acccctgttgatcgcgcagggttatatgttccaggcggacgagcagcttatcctagtaca
gtcttgatgaatgcggttccggcaaaagtagcaggtgtcgagcgacgggtgatggtaaca
cccccgggtgctgacggtaaaattactcctgcggtattagttgcagcacaagaggctgga
attgaagagatttatcggatcggaggggcgcacgcgatcgcagccttagcctatggaaca
gaaaggattccagaagtggatgtgattacagggccaggcaatctctatgtcactcttgcg
aaaaagatggtttatggcacagtgggcattgattctctggcgggtccctcggaagtgttg
gtgattgcggatcagaatgcaaatccagtttacgttgctgctgatttgttagcccaagcc
gaacatgatccgatggcagcagcaatcttgttaacaacagaagagaaactcgcacagcaa
gtgcaggaggaagtgcaaaaacaattagccgatcatcctcgtcgcactttaacagaaaaa
tcgatcgcgaattatggtgtggtcattattgttaactcccttaaggaagcagcagaatta
tctaatattttcgcccccgaacatttagagttagaagtggaagacccctgggaaatgttg
catctgatccgccatgcaggggcgatttttatgggacattcgactccagaagcggtaggg
gattatctcgccggtcccaatcataccttacccacgtctggggctgctcgttatgcgtct
gcgttgggggtagaaacgtttatgaagcattccagcttaattgaatattcccagactgct
ttagatcatgtttcccaagccattcaaaccttagcggaagcagaaggattgcattctcac
agtgaatccgtccgtttacgcagggaaaacaatcaagagtaa

DBGET integrated database retrieval system