KEGG   Halothece sp. PCC 7418: PCC7418_2417Help
Entry
PCC7418_2417      CDS       T02379                                 

Definition
(GenBank) MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao02020  Two-component system
hao02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hao00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PCC7418_2417
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PCC7418_2417
Enzymes [BR:hao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     PCC7418_2417
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PCC7418_2417
Two-component system [BR:hao02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PCC7418_2417
Bacterial motility proteins [BR:hao02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PCC7418_2417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest PAS_10 CheR_N PAS_4 IncA CENP-F_leu_zip FapA PAS_8 HOOK Leu_zip Seryl_tRNA_N Jnk-SapK_ap_N GAS DUF3552 Spc7 Fez1 HMMR_N ADIP TMPIT ATG16 Rootletin Sec8_exocyst HAUS-augmin3 Med30 DUF2203 Atg14 DUF812 Peptidase_S64 Mnd1 APG6
Motif
Other DBs
NCBI-ProteinID: AFZ44564
UniProt: K9YCH2
Position
2641143..2644061
Genome map
AA seq 972 aa AA seqDB search
MSSQGKTDLQNTKNPNNTFPIVAIGASAGGLEALENFFSQVTTDSEMAYLVLVHSSLEHP
HFLPEILQRTTSVPISIAENGNQIFPNHIYMIPSQMRVRVEQDCIYLSSVERRELLLTID
MFFIALAENEPQRTVGVILSGMGSDGTLGVKALKAQEALILVQSPETSAYTEMPDSAIST
GVVDGILPPAEMPRLIEQYFQQQGITEEEITAQEWLSEIFSLIRAQIGHDFSSYKQNTLL
RRIKRRMTLHQIETYAEYFNFLQDHPKEVNNLFREFLIGVTSFFREESAFEFLQQEVLPP
ILQSIPDGGTFRAWVSGCSSGEEVYSLAMILRELIDEMPKQINLQLFGTDIDQLAIDRAR
EGLFPASIATDVSQQRLRRFFRREGQFYRVSRDIRYSVVFSLQDVLKDPPFSRLNLLSCR
NLLIYLNEEAQRRLLPLFHYTLQPSGILMLGGSESIGSFQNLFHTLDLKHKIFQRREVAR
SLRQSVHFPTGAFLNLARPRRSGMTSRQNEDQNFERLIQNILLEEYSPTAVLIESNGQIL
HVQGRTGKFLETVSGPPTNNIFDMAREGLRVELASAIRSAISSGEMITRQQIPVRSNGQR
ELVKFSVKPLTMPEGLAGRLLVLLEVLDTALTDENEDNTAQSLSMQQRDGRIAELERELQ
NTRESHQTTIEELESSNEELQATNEELESSNEELQATNEELESSKEELQSLNEELQTLNE
ELQTKVEELSAAEDDMRNLLNSTSIATIFVDQQLQVKRFTPQAREIVNLIQNDVGRPLED
IATNLQEVELGAELQEVLDTLHSKVEAVQNHDGTWYQMRIMPYQTTDNRIEGAILTFTNI
DDLKQIEAEIASINVELEQIKIVILDILEANTSPLILIDPDQKIVRANQAFHEFMNLRLG
TNLQSLEQALSQQIGDFLQGNEDFSDVPFLYTASEQNECYYRVDGKVIGDVFNGNYYFLL
AFYEGDNNNLDN
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcccaaggaaaaaccgatctccagaatacaaaaaaccctaataatacctttccc
attgttgccattggtgcatcggctgggggattagaagccctagaaaatttcttttctcag
gtgacaaccgatagtgagatggcttatttggtgctggttcactcttcgttagaacatccc
cattttctcccagagattctacaacgcaccacctcggttcccatttcaattgctgaaaac
ggtaatcaaatttttcctaatcatatctacatgattccctcgcaaatgagggttcgagta
gaacaagattgcatctatctctcgtctgttgaaagacgagaacttctcttaacgattgat
atgttcttcattgcactggcggaaaatgaacctcagcgaacagttggagtaattttatca
ggaatgggtagtgatgggacactgggagtaaaagcactcaaagctcaagaagccttaatc
ttggtacaatcgccagaaacctcagcttatacagaaatgcccgatagtgcaatttcgacg
ggggtagtggatggaattttaccgccagcagaaatgcccagactgattgagcagtatttt
cagcagcaagggattacggaagaagaaataaccgctcaggaatggttgagtgaaattttt
agcctcattcgcgctcaaattgggcatgatttttcttcttataagcaaaatacacttctt
cgtcgcattaagcgccgaatgactctccatcaaatagaaacttatgctgaatattttaat
tttttacaggatcatcccaaagaagttaataatttatttcgtgaatttttaattggtgtg
accagtttttttcgagaagaaagtgcatttgaatttttacaacaagaagtcctcccgcct
attttgcagtctatccccgatggtggaacgtttcgggcgtgggtttctggttgttccagt
ggtgaggaggtgtattccttagcgatgattctgcgggaactgattgatgagatgccaaaa
cagattaatttacagttgtttggcacagatattgatcaactggcgattgatcgcgccaga
gaagggctttttccagcgagtattgccacggatgttagtcagcaacggttacgacggttt
tttcgacgggaaggtcagttttatcgtgtgagtcgagacattcgctattccgtggtattt
tcgctgcaagatgtcctcaaagatccccctttttctcgtttgaacttgcttagttgtcgc
aatctcttaatttatctgaatgaagaagcacaacgccgactgctgcctttgtttcactat
acgttacaaccttcaggaattttgatgttggggggttcggaaagtattggcagtttccaa
aatttatttcataccttagatctgaaacataagatttttcaacggcgagaagttgcgcga
tcgctgcgtcaatctgtccattttcccactggagcatttcttaacttagctcggccccgt
cgctcggggatgacctctcgccaaaatgaagaccagaattttgagcgactcattcaaaat
attttactggaagaatattctcccaccgcagttctcattgaaagtaatggacagattctt
catgtgcaaggacgtacagggaagtttttagaaacggtcagtggtccccccaccaataat
atttttgatatggcgcgagaaggcttaagagtggaacttgcctcagcgattcgatctgct
atttcttctggtgagatgatcactcggcaacagattcctgttcgcagcaatggacaacgg
gaactggtgaagttttctgtcaaacctctcaccatgccagaaggattagcgggtcgcctc
cttgttttattggaagtgcttgacactgctctaacagacgaaaatgaagataacactgct
caaagtctctctatgcaacaacgagatgggcgtattgctgaactagaaagagagttacaa
aacacccgcgaaagccatcaaaccaccattgaagaattagaatcgtcgaatgaggaactg
caagcgactaacgaagagttagaatcgtcgaatgaggaactgcaagcgactaacgaagag
ttagaatcctcaaaggaagagttgcaatcgttgaatgaggaactacaaactctcaacgaa
gaactacaaaccaaagtggaagaattatccgcagccgaagacgatatgcggaatttgctc
aatagcacgagtatcgcgacgatttttgtggatcagcaactgcaagtcaaacgctttaca
ccgcaagcccgagaaattgtcaatttaattcaaaacgatgtcggtcgccccctagaagat
attgccacgaatttacaagaggtggaactcggtgcggagttgcaagaggttttagacaca
cttcactcaaaagttgaagcagtacaaaaccatgatggcacttggtatcaaatgcggatt
atgccctatcaaaccacagataaccgcatagaaggggcaattctgacctttacgaatatt
gacgatttgaaacaaatagaggcagaaatcgcaagtattaatgttgaattagaacaaata
aaaattgtgattcttgatattttagaggcgaatacaagcccgttaattttaattgaccca
gaccagaagattgtgagagcaaaccaagcctttcatgaattcatgaatctgagactcggg
acaaacttgcaatccttagaacaggctttatcgcagcaaattggcgactttttacaaggc
aatgaggatttttctgatgttccttttctctatactgcctcggaacaaaatgaatgttat
tatagggtcgatgggaaagtaatcggggacgttttcaatggaaactattattttttatta
gctttttacgagggagacaataataatcttgacaactag

DBGET integrated database retrieval system