KEGG   Halothece sp. PCC 7418: PCC7418_2959Help
Entry
PCC7418_2959      CDS       T02379                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
hao  Halothece sp. PCC 7418
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PCC7418_2959
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC7418_2959
  Lipid metabolism
   00071 Fatty acid degradation
    PCC7418_2959
  Amino acid metabolism
   00350 Tyrosine metabolism
    PCC7418_2959
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PCC7418_2959
   00626 Naphthalene degradation
    PCC7418_2959
Enzymes [BR:hao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PCC7418_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3214998..3216023
Genome map
AA seq 341 aa AA seqDB search
MANTMKAAIAEEFGKPLQLKEVEIPQPQAEQVLVKLAVSGVCHTDVHAADGDWPVKPNIP
FIPGHEGVGHVAEVGSHVTHLEKGDHVGIPWLHTACSRCEYCVTGQENFCPTQENTGYSV
NGTFAEYVLADANHATKIPQPLESTDAAPILCAGVTTYRGLKETHTKPGDWVVISGIGGL
GHLAVQYAKAMGLRVIALSRTPKKLELAQELGADKTINVSETDPGQAVQDQIGGAHGALV
TAVSTQAFHQAVSTLQRSGTCSMVGLPPGEFPLSIFEVILKGIDIQGSLVGTRADLREAL
QFAAEGHVKPAIETQPLEAVNATMERLKKGEVNGRVVLTMS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaccatgaaagctgcaatcgcagaagagtttggcaaaccgctacaactcaag
gaagtagaaattccgcaacctcaagcggaacaagttctagtcaaacttgcagtcagtgga
gtttgccatacagatgtccatgctgctgatggtgactggccagtgaagccgaatattccg
tttattccgggtcatgaaggcgtaggtcatgttgctgaagtgggctcccatgtcactcat
ttagaaaaaggagatcatgtagggattccttggctacatacagcttgttctcggtgtgaa
tattgtgtcactggacaagaaaatttctgcccaactcaagaaaataccggctatagtgtg
aatggaacatttgccgagtatgttctagcggatgcgaatcatgccacgaaaattcctcag
cctctagagtcaacggacgctgcgccaattttatgtgcaggagtaaccacctatcggggt
ctgaaagaaacccataccaaaccgggagattgggttgtgatttctggtattggtggactg
ggacatttagccgtgcaatatgccaaagccatggggcttcgtgtgattgccttatcccgg
actcccaaaaaactagaactggctcaagaattgggagcagacaaaacaattaatgtgagc
gaaacagatccgggtcaagcggttcaagatcagattgggggagctcatggcgcactggta
actgccgtttccacacaagcctttcatcaagcagtgagtaccttacaacgcagtggtact
tgttccatggttggtttacccccaggagagtttccgctttccatctttgaggtcattttg
aaaggcattgatattcaagggtctctggttggcactcgtgctgatttacgggaagccctt
caatttgcagccgaaggtcatgtgaagcctgcaattgaaactcaacccttagaagcagtt
aacgcgactatggaacgtctgaaaaaaggagaagttaatgggcgtgttgtcttaaccatg
tcataa

DBGET integrated database retrieval system