KEGG   Halothece sp. PCC 7418: PCC7418_3257Help
Entry
PCC7418_3257      CDS       T02379                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hao  Halothece sp. PCC 7418
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC7418_3257
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7418_3257
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PCC7418_3257
Enzymes [BR:hao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PCC7418_3257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3506125..3507420)
Genome map
AA seq 431 aa AA seqDB search
MALATETTNAKPTYTKLVSKEGGTEYDLKPIHVCEETFAPLEVAYDYEAIRAQVSRESIA
AGPKSIWRYKPFLPVTGDVIDVGTGMTPLIKSTRLARRLGLKELYLKNDAVNMPTLSFKD
RVVSVALSKAKEFGFSTVSCASTGNLANSTAAISASAGLECCVFIPADLEAGKVLGTLIY
NPTVMAVKGNYDQVNRLCSEVANGYGWGFVNINLRPYYSEGSKTLGYEVAEQLGWKLPDH
VVAPLASGSLYTKIYKGFQEFVKTGLVDDKFVRFSGAQAEGCSPISQAFKEGRDFITPVK
PNTIAKSIAIGNPADGVYALDVARKTNGNIEDVTDAEIIEGIQLLAETEGIFTETAGGTT
IAVLKKLVEAGKIDPDESTVAYITGNGLKTQEAVQGYIGEPFAIDPNLDSFERAWQRSRT
LDRLEWQQVLV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgcaactgaaaccaccaatgccaaacccacctacaccaaattagtctcgaaa
gaaggaggcacagaatacgacttaaaaccgattcatgtttgtgaagaaacctttgcccct
ttagaagttgcctatgactatgaggcgattcgcgctcaagtcagcagagaaagcattgca
gcaggtcccaagtccatttggcgttacaaaccctttttaccagttactggagatgtcatt
gatgttggcactgggatgactcctctgattaaatccacccgcttggcgcgtcgtctggga
ttaaaagagctttatcttaaaaacgatgcggtgaatatgcccaccctgagctttaaagac
cgtgtggtttctgtagccctcagtaaagcgaaagaatttggattttctactgtttcttgt
gccagtaccggaaaccttgctaactctaccgcagcaatttccgccagtgctggtttagaa
tgttgtgtctttattcctgcggatctcgaagctgggaaagtcttaggaacattaatttat
aaccccactgtcatggcagtgaaaggaaactacgaccaagtgaaccgcctctgtagtgaa
gtagccaacggttacggctggggctttgttaatattaatcttcgtccttattattctgaa
ggctcgaaaaccctcggttatgaagtggcggaacaactcggctggaaacttcctgatcat
gtggtcgcgcccttagcttcgggttctctctatacaaaaatttataaaggcttccaagaa
tttgtgaaaacgggtttagtcgatgataagttcgttcgtttcagtggtgcacaagcagaa
ggctgttccccgatttctcaagcatttaaagaaggacgggactttattacgcctgttaag
ccgaatacaattgcaaaatcgatcgcgatcggaaaccctgctgatggggtttacgcttta
gatgttgctcgtaaaaccaatggcaatattgaagatgtcaccgatgctgaaatcatcgaa
gggattcaactcttagcagaaacagaaggaatcttcactgaaaccgcaggcggaacaacg
atcgcggttctgaaaaaattagtcgaagcaggtaaaattgatccagacgaaagcaccgtt
gcttatatcacaggtaacggactgaaaacccaagaagcggtacaaggttacattggcgaa
cccttcgcgattgatcccaacttagatagttttgaacgcgcttggcaacgctctcgcacc
cttgatcgtttagagtggcagcaagtgttagtatag

DBGET integrated database retrieval system