KEGG   Halothece sp. PCC 7418: PCC7418_3468Help
Entry
PCC7418_3468      CDS       T02379                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hao  Halothece sp. PCC 7418
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC7418_3468
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC7418_3468
Enzymes [BR:hao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PCC7418_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3755130..3756017
Genome map
AA seq 295 aa AA seqDB search
MKIRRRPPNPAVNVDTVRYQVAFPNDEPQNILEKIVWQKEKEVDRQREKLPFLQLGKQVK
DNAPPIRDFLGALHNGKLNPALIAEVKKASPSKGVIREDFDPVALAKTYEEAGASCLSVL
TDVEFFQGSFENLGLARNAVNLPLLCKEFIIYPYQIYQARLVGADAILLIVAILNDQDLN
YFVKIVNSLGMTPLVEVHTLEELDRALNIDGIRLIGINNRNLEDFSVNVQTTADLIAQRQ
EQFDQKEITIVSESGLHTPADLKVVQEAGANAVLIGESLLVQPDPKRAIESLYNR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaagacgacctcctaatcctgctgttaatgttgatacggtgcgctatcaa
gtggcgtttcccaatgatgaaccgcaaaatattttagaaaaaattgtttggcaaaaagag
aaagaagtggatcgccaacgggaaaagttgccatttcttcagttaggaaaacaagtgaaa
gataatgctcccccaatacgggattttttaggggctttgcacaatggaaaactgaatcca
gcattaattgcagaagtcaaaaaagcctctcccagtaaaggggtgatccgagaagatttt
gatccagttgccctggcgaaaacttatgaagaagcaggggcaagctgcttatctgtttta
accgatgtggagttttttcagggcagttttgaaaatttagggttagctagaaatgcagtt
aatcttccccttttatgtaaggaatttattatttatccttatcaaatttatcaagcgcgg
ttagtgggtgcggatgcgattctattaattgttgcgatcttaaatgatcaggatttaaac
tattttgtcaagattgttaatagtttgggcatgactcctttagtagaagtgcatacttta
gaagaactcgatcgcgctctcaatattgatggcattcgtctcattgggattaataaccgt
aacttagaggatttctctgtgaatgtccaaacaacagccgatttaatcgctcaacgccaa
gaacaattcgatcaaaaagagattaccatagtcagtgagtcgggattgcatacgcctgcg
gatctgaaagtggtacaagaagctggagcaaatgcggtcttaattggagaatcactctta
gtgcaaccagatcccaaacgcgcgatcgaatctttgtataataggtag

DBGET integrated database retrieval system