KEGG   Halothece sp. PCC 7418: PCC7418_3468Help
Entry
PCC7418_3468      CDS       T02379                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hao01100  Metabolic pathways
hao01110  Biosynthesis of secondary metabolites
hao01130  Biosynthesis of antibiotics
hao01230  Biosynthesis of amino acids
Module
hao_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC7418_3468
Enzymes [BR:hao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PCC7418_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE
Motif
Other DBs
NCBI-ProteinID: AFZ45580
UniProt: K9YGQ9
Position
3755130..3756017
Genome map
AA seq 295 aa AA seqDB search
MKIRRRPPNPAVNVDTVRYQVAFPNDEPQNILEKIVWQKEKEVDRQREKLPFLQLGKQVK
DNAPPIRDFLGALHNGKLNPALIAEVKKASPSKGVIREDFDPVALAKTYEEAGASCLSVL
TDVEFFQGSFENLGLARNAVNLPLLCKEFIIYPYQIYQARLVGADAILLIVAILNDQDLN
YFVKIVNSLGMTPLVEVHTLEELDRALNIDGIRLIGINNRNLEDFSVNVQTTADLIAQRQ
EQFDQKEITIVSESGLHTPADLKVVQEAGANAVLIGESLLVQPDPKRAIESLYNR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaagacgacctcctaatcctgctgttaatgttgatacggtgcgctatcaa
gtggcgtttcccaatgatgaaccgcaaaatattttagaaaaaattgtttggcaaaaagag
aaagaagtggatcgccaacgggaaaagttgccatttcttcagttaggaaaacaagtgaaa
gataatgctcccccaatacgggattttttaggggctttgcacaatggaaaactgaatcca
gcattaattgcagaagtcaaaaaagcctctcccagtaaaggggtgatccgagaagatttt
gatccagttgccctggcgaaaacttatgaagaagcaggggcaagctgcttatctgtttta
accgatgtggagttttttcagggcagttttgaaaatttagggttagctagaaatgcagtt
aatcttccccttttatgtaaggaatttattatttatccttatcaaatttatcaagcgcgg
ttagtgggtgcggatgcgattctattaattgttgcgatcttaaatgatcaggatttaaac
tattttgtcaagattgttaatagtttgggcatgactcctttagtagaagtgcatacttta
gaagaactcgatcgcgctctcaatattgatggcattcgtctcattgggattaataaccgt
aacttagaggatttctctgtgaatgtccaaacaacagccgatttaatcgctcaacgccaa
gaacaattcgatcaaaaagagattaccatagtcagtgagtcgggattgcatacgcctgcg
gatctgaaagtggtacaagaagctggagcaaatgcggtcttaattggagaatcactctta
gtgcaaccagatcccaaacgcgcgatcgaatctttgtataataggtag

DBGET integrated database retrieval system