KEGG   Halothece sp. PCC 7418: PCC7418_3744Help
Entry
PCC7418_3744      CDS       T02379                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hao  Halothece sp. PCC 7418
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hao00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4040530..4041474)
Genome map
AA seq 314 aa AA seqDB search
MRHYTLTAPAKINLHLEIIGDRADGYHELVMILQGIGLEDRIHLYAGSTQAIHLHCEHPD
VPLGSDNIAYKAAQLMCQEYPQTYARYGGVDISIEKNIPVAAGLAGGSTDAAAVLVGLNL
LWKLGLTQPELQTLASKLGSDIPFCLEGGTALALGRGEEISALDDLQEAKLILAKHRNLY
VSTAWAYQTYRQQFEESYVQQPEEVEAGRKQAHSANLVSAIAEQDYPKIGQLLYNDLEKV
VFPAYPQVEALKTAFQEENDVLGAMMSGSGPTVFALCPATAATEEIVEAVKSKLNDSTID
FWTTELSSHGIQVN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgccactacacactgactgcaccagcaaaaattaatcttcatctggaaattatcggc
gatcgcgcggatggttatcacgaactggtcatgattttacagggaatcggcttagaagat
cgcattcatctttacgcgggtagcactcaagccattcatctccattgtgaacacccagac
gttcctctcggctctgataatattgcttacaaagcagcacagttgatgtgccaagagtat
ccccaaacctacgcccggtatgggggagttgacattagcattgaaaaaaatattcctgtt
gctgcggggttagctgggggatcaacagatgcagcagcagttctggtgggccttaattta
ttatggaagttaggcttaacccaacctgaattacagaccttagccagtaaactgggatca
gatattcccttttgcttagaaggcggaactgcactggctttagggcgcggggaagaaatt
agtgctttagacgatttacaagaggcaaagctcattctcgccaaacatcgcaacttatat
gtttctaccgcttgggcgtatcaaacctatcgtcaacagtttgaagaaagttatgttcag
cagccagaggaggtcgaagcgggacgaaaacaagcccattctgcgaacttagtcagcgcg
atcgcggaacaagattatccgaaaattggacaactcctctataacgatttagaaaaagtc
gttttccctgcttatccccaagtggaagccttaaaaaccgcctttcaggaagaaaatgac
gttcttggggcgatgatgtctgggagtggccccacagtctttgcactctgtccagccaca
gcagcaacagaagagattgtcgaagccgtgaagtcaaaactgaatgattccaccattgat
ttttggactacagaattaagtagtcatgggatacaagtcaattga

DBGET integrated database retrieval system