KEGG   Halothece sp. PCC 7418: PCC7418_3824Help
Entry
PCC7418_3824      CDS       T02379                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hao  Halothece sp. PCC 7418
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC7418_3824
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC7418_3824
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PCC7418_3824
Enzymes [BR:hao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PCC7418_3824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4134155..4135273
Genome map
AA seq 372 aa AA seqDB search
MTTTRVSPVSPNPSPNRLKDQTSWSGLIETYRPFLPVTSTTPVVTLLEGNTPLIPAFSLS
DRIGRGVKVYVKYDGLNPTGSFKDRGMTMAISKAKEAGAQAVICASTGNTSAAASAYAIR
AGLKPFVLIPDGYVALGKLAQALLYGAEVIAVDGNFDDCFQLVKAIAEEYPVTLVNSVNP
YRLEGQKTAAFEIVDQLGEAPDWLCIPVGNAGNISAYWMGFCQYHQHNKSEKLPRMMGFQ
AAGSAPMVEGHPVKSPNTIATAIRIGNPANWKRAMAVQDASQGEFNAVTDEEILEAYRIL
GREEGVFCEPASAASVAGLLKVKDRIPSQSTVVCVLTGNGLKDPQSAIDHAQAQVKSGVP
SQLEAVAEAMGF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacaactagagtttcgcccgttagccccaatcccagcccaaatcgcctcaaagat
cagacaagttggtctggtctgatcgaaacctatcgtccttttttgcccgttacttcgaca
acccctgttgtcaccctcttagagggaaatacgcctttgattccagcttttagcctttca
gatcgcattggacggggcgtaaaagtttatgtgaaatatgatggtttaaatcccacaggt
agctttaaagaccgtgggatgaccatggcaatttctaaagcaaaagaagcaggtgcgcaa
gctgtcatttgcgccagcacgggtaacacttctgctgctgcctccgcttatgcgattcgt
gccgggttaaagccgtttgtccttattccagatggttatgttgcccttggcaaactcgcc
caagccctactttatggcgcggaagtgattgcagtggatgggaactttgatgattgcttc
cagcttgtcaaagccattgcagaagaatatcctgtgaccttagtgaactcagttaatcct
tatcgcctcgaaggacaaaaaaccgcagcctttgaaattgtcgatcaattgggagaagcc
cccgactggttatgtattcctgttggtaatgcggggaatatctcagcatattggatgggt
ttttgtcaataccatcagcacaataaatcggaaaaactgcctcgcatgatgggcttccaa
gcagcaggttcggctcccatggtagaaggtcatcccgtgaagtctcctaataccattgcc
actgcgattcggattggcaatccagcaaactggaaacgagcgatggcggtacaagacgcg
agtcaaggggaatttaatgccgtcactgatgaagaaattttagaagcctatcggatttta
gggcgagaagaaggggtcttttgtgaaccagcaagtgcagcctctgtcgcgggcttatta
aaggtgaaagatcgcattccgagtcaaagtacggttgtctgtgtcttgactggtaatggc
ttaaaagatcctcaaagtgccattgatcatgcacaagcgcaagtaaaatcgggtgtgccc
tcgcagttagaagcagttgcggaagctatgggcttttaa

DBGET integrated database retrieval system