KEGG   Glaesserella parasuis SH0165: HAPS_0190Help
Entry
HAPS_0190         CDS       T00825                                 

Gene name
bgaC
Definition
(GenBank) beta-galactosidase, glucosyl hydrolase family protein
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HAPS_0190 (bgaC)
Enzymes [BR:hap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HAPS_0190 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 Cellulase
Motif
Other DBs
NCBI-ProteinID: ACL31886
UniProt: B8F3I4
Position
complement(205961..207751)
Genome map
AA seq 596 aa AA seqDB search
MPFQIGEKDFLLNGKPFKILSGAVHYFRIVPEYWYKTLYNLKAMGCNTVETYVPWNLHQP
QPDQFNFSKRADLVKFLQTAKDLGLYVILRPTPYICAEWEFGGLPAWLLNIPNIRLRQND
PLFIAEIDRYFQELLPRIAPYQITQGGNILMMQIENEYGSFGNDKNYLRAIRALMLIHGV
NVPLFTSDGAWQNALEAGALIEDDILPTGNFGSRSNENLDELQRYIDKHGKSYPLMCMEF
WDGWFNRWKEPVIRRDAQDLANCTKELLERASINFYMFQGGTNFGFWNGCSARLDTDLPQ
VTSYDYDAPVHEWGEPSEKFYLLQKVLGQYPDASPIVDPILPNITAYPPLAVQNEVSLFG
TLDTISECYESPFTQTMEQLGHYYGYLLYRAKPMAYSGEIKLRIYQGRDRIQIFNDKQKV
ATQYQHEIGNEVMLQTPNGEFQLDLLVENMGRVNYGGKLLAPTQHKGIGAGAVLDLHFHT
GWQQYAIDFDRLEEIDFDGEKDSQTPSFYQFKLHLDQEPQDTFIDTRAFGKGVIVVNGEN
LGRYWNEGPTCYLYLPAPLLHKGENEIIVFETEGVKIDSLTFSDKPIYKELNTKNL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccaaatcggcgaaaaggatttcctactcaacggaaaaccgttcaaaatcctg
tcaggtgcagtacattattttcgtatcgtgccggaatactggtacaaaacactctacaac
ctaaaggcaatggggtgtaacacggtagaaacctatgtgccgtggaacttacatcagcca
cagcctgatcaatttaacttcagcaagcgggcggatttagtcaaatttttgcaaacggca
aaagatctagggctgtacgttattcttcgcccaacaccttatatctgtgcggaatgggag
tttggcggattgcctgcgtggttactcaatatcccgaatatccgcttacgccaaaacgat
ccgctgtttatcgctgaaatcgaccgctattttcaagaactacttccacgcattgcccct
tatcaaattacccaaggcggtaatatcctaatgatgcaaatcgagaacgaatacggctcg
ttcggcaatgataaaaactacctaagagctattcgggcgttgatgttaattcacggggtg
aacgtaccgcttttcacgtcagacggtgcgtggcagaacgccttagaagcaggggcgttg
atcgaagatgatattttgccgacgggcaacttcggctctcgttccaatgaaaatttagat
gagttgcaacgttatattgataagcacggcaaatcttacccgttgatgtgtatggaattt
tgggacggctggtttaaccgctggaaagagcctgtgatccgccgtgatgctcaagatttg
gcgaactgcaccaaagagctactcgaacgggcaagtatcaatttctatatgttccaaggc
ggaacgaattttggcttttggaacggctgttccgcacggttagacaccgatttaccgcaa
gtaaccagctacgactatgatgcccctgttcacgaatggggcgagccgtcagagaaattc
tacctgctacaaaaagtgttagggcagtaccctgatgctagcccgattgtcgatccgatt
ttgccaaatatcactgcttacccaccgcttgctgtgcaaaatgaagtgtcgctgtttggt
actttagacacaatcagcgaatgctacgaaagtccgttcactcaaacaatggaacagcta
gggcattactacggttatctgctttatcgagccaaaccgatggcatacagcggtgagatc
aagctgagaatttaccaaggcagagatcgtatccagattttcaacgataaacaaaaagtc
gccacccagtaccaacacgagatcggcaatgaagtgatgttacagacacccaatggcgag
ttccaacttgatctgttagtggaaaatatgggacgggttaattacggcggtaagctactt
gcaccgacacaacataaagggatcggtgcaggggctgtgcttgatctgcatttccacaca
ggctggcaacagtatgcgattgattttgaccgcttggaagagattgattttgatggcgag
aaagatagccaaacgccttcgttctatcaatttaagttacacctagaccaagaaccgcaa
gatacctttattgatacccgtgcgttcggcaagggggtgattgtggtaaatggtgagaac
ttagggcgttactggaatgaaggcccgacttgttatctctatctgcctgcaccgttactg
cataaaggtgaaaatgagattatcgtctttgaaacagaaggggtgaagatcgatagctta
acatttagtgataagccgatttataaagagttgaatacgaagaacttataa

DBGET integrated database retrieval system