KEGG   Haemophilus parasuis SH0165: HAPS_0230Help
Entry
HAPS_0230         CDS       T00825                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HAPS_0230 (folK)
Enzymes [BR:hap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HAPS_0230 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(257942..258418)
Genome map
AA seq 158 aa AA seqDB search
MTTVYVALGSNLEDPLAQLKQAVVSLQTFAKNLKVSSFYGSKPLGPQDQPDYVNAVVKFD
TDLTAIELLDKLQSIENEQGRVRLRRWGERTLDLDILLYGNEQIQSERLTVPHYDMHNRE
FVIVPLYEISPELVLPSGKSLAQLYPQFAEHQMNIIVL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccgtttatgtggctcttggctctaacttagaagatccgcttgctcaacttaag
caagcggttgtttcgttgcaaacctttgcaaaaaatctgaaagtcagctctttttacggc
agtaaaccactcggcccacaggatcaacctgactatgtgaatgccgtggtaaaattcgac
acggatctcaccgctatcgagctacttgataaattgcaaagtattgagaatgaacaaggg
cgagttcgtttacgtcgttggggagaacgcactctcgatcttgatattttgctctatggc
aatgaacaaattcaaagcgaacgtctaactgttcctcactacgatatgcacaaccgagag
tttgtgattgtaccgttatatgaaatcagtcctgaattggttttgccgagtgggaaatct
ttagcacaactttatccgcaatttgcagagcatcagatgaatataatagttttataa

DBGET integrated database retrieval system