KEGG   Haemophilus parasuis SH0165: HAPS_0233Help
Entry
HAPS_0233         CDS       T00825                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HAPS_0233 (malQ)
Enzymes [BR:hap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HAPS_0233 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(260708..262729)
Genome map
AA seq 673 aa AA seqDB search
MKQNHPFLNRYFVDEHGRRVYAQPSVYGKVAKLLGLQKSRKILPLVKVVKQGEQVFIPLF
VADKTQTVHANWTLTLESGEILTGKCKRNSIDLPRDLPLGYHQLSLNGTTAECRIIVTPE
RAYQPQELAEHKKLWGAILQLYTLRSEQNWGIGDFGDLAEFLTKLAEKGGDFVGLNPIHS
LFPANPEGASPYSPSSRLWQNIAYINVGAIDAFQQSREAQTWFNSADIQRQLNEARQKDY
VDYSQVMWLKLQGLRLAYEQFKQQDQTAFEQFITENGEALKVQGTFDALHQWLSSQFSEQ
WGWNCWDAKYQDYHTASVQQFQQEQSDLVRFYMWLQFVAQQQLKACNELAKQLGMPIGFY
RDLAVGVADNGAETWADKDLFVLGASVGAPPDIMAPQGQNWGLSPMHPEVLQERGYQPFI
DLLRANMKDCGALRIDHILGFARLWWVSKGDSAKNGAYVKYPLEDLLSILALESQRHQCL
IIAEALGTVPKGMLEALEEKGILAYNIFYFEYDHQGSKPLANYPYQAMTTLSTHDLPTVQ
GYWKGYDFELGQKYGVYPNEKVLNILKNTRHTNKEAIRRAVEAVQPLEADSAGVTQTFNH
QLQSYVADTNSVLFGSQPEDWLNMLEPVNIPGTSTEYPNWRRKLSKTTQEIFANQTIVQL
LEKIEAKRRGILN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatcacccatttttaaatcgttacttcgtggatgaacacggtcgccgtgtt
tatgcccaaccgtccgtttatggcaaagtggcaaaattgctcggtttgcaaaaaagtcgc
aaaatcctaccgcttgttaaagtcgtcaaacaaggcgagcaagtctttattccgcttttt
gtggcggataaaacccaaaccgttcacgcaaactggacgttgacccttgaaagcggtgag
attttaacgggaaaatgcaaacgcaatagcattgacctgcctcgtgatttaccccttggt
tatcatcaattaagtctaaacggcacaaccgcagaatgtcgcattatcgttacccctgaa
cgtgcttaccaaccgcaagaactggcagagcataaaaaactatggggcgcgattttacag
ctctacaccctacgttcagaacaaaactgggggatcggcgactttggtgatttagcggaa
tttttaacaaaattagcagaaaaaggcggtgattttgttgggttaaatccaattcattcg
ttattcccagccaatcctgaaggggcaagcccttacagcccatcttctcgtttatggcaa
aacattgcttatatcaacgttggggcgattgacgctttccaacaaagccgtgaagctcaa
acttggtttaattcagcggatattcaacgtcaattaaacgaagctcgccaaaaagattat
gtcgattattcacaagtgatgtggctgaaattgcaaggcttacgcttggcatatgagcaa
tttaaacagcaagatcaaaccgcttttgagcaatttattactgaaaacggcgaagccttg
aaagtgcaaggcacgtttgatgctctacatcagtggctctcttctcaattcagcgaacaa
tggggctggaactgctgggacgcaaaatatcaagattatcacaccgcttctgtgcaacaa
ttccaacaagaacagagcgatttagtccgtttctatatgtggttgcaatttgtggcacaa
caacagctcaaagcctgtaacgaactggcaaaacagctcggtatgccgatcggtttctac
cgtgacttagccgttggcgtggcagataacggggcggaaacgtgggcggataaagatctg
ttcgtgttaggtgcatctgtgggtgcaccaccggatattatggcaccgcaagggcaaaac
tggggcttatcgccaatgcaccctgaagtgttgcaagagcgtggttatcagccgtttatc
gacctactgcgtgccaatatgaaagattgtggggcattgcgtatcgaccacattctcggc
tttgcccgtttatggtgggtgtcgaaaggcgactcggcgaaaaacggcgcttatgtgaaa
tatccgttggaagatttactttcaatcttagcccttgaaagccaacgccaccaatgttta
atcattgccgaagccttgggaactgtaccgaaaggaatgttagaagccttagaggaaaaa
ggtattttagcctacaacattttctattttgagtacgaccatcaaggaagcaaaccattg
gctaactatccatatcaagcaatgaccaccctaagtacccacgatttaccgacggtacaa
ggctactggaaaggctatgatttcgagttagggcaaaaatatggcgtttacccgaatgag
aaagtgcttaacattctgaaaaacactcgccatacaaacaaagaagcgatccgccgtgcc
gttgaagcggtacaaccgctagaagcggatagtgcaggcgttactcagacctttaaccac
cagctacaaagctatgtggcagataccaacagcgtactattcggctcacaaccggaagac
tggctaaatatgctagagccggtaaatatccctggaacaagcaccgaatatccaaactgg
cgcagaaaattgagtaaaaccacacaagagatttttgcgaatcagacgattgtgcagttg
ttagaaaagattgaggcgaaacggagaggaatattaaattaa

DBGET integrated database retrieval system