KEGG   Haemophilus parasuis SH0165: HAPS_0463Help
Entry
HAPS_0463         CDS       T00825                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HAPS_0463 (galU)
   00052 Galactose metabolism
    HAPS_0463 (galU)
   00500 Starch and sucrose metabolism
    HAPS_0463 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HAPS_0463 (galU)
Enzymes [BR:hap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HAPS_0463 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(495260..496147)
Genome map
AA seq 295 aa AA seqDB search
MKVIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVNECVAAGVREIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLVEVRSIVPKDVTLMHVRQGQAKGLGHAVLCGRAVVGN
EPFAVVLPDVLLADFTADQKTENLAAMIQRFKETGKSQIMVVPVAKENVSNYGIVDCQGA
ELQPAGTAKIANIIEKPSIEEAPSNFAVVGRYVFSAEIWDLLAKTPVGVGDEIQLTDAID
MLIEQQEVDAFHMTGKTFDCGDKLGYMEAFVEYSLNHDKFGGEFKDYLKKLSKSL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgattattcctgtcgcaggtcttggtactcgtatgcttcctgcaaccaaagca
atcccaaaagaaatgctaaccattgcagacaaaccgttgattcaatatattgtaaacgag
tgtgtggctgcaggagtaagagaaattgtgcttgtcactcattcatctaaaaacgctatc
gaaaaccactttgatacatcgtttgaactcgaaacaatgttagaaaaacgagtgaaacgt
cagctattagttgaagtgcgttcgattgtacctaaagatgtgaccttgatgcacgttcgt
caggggcaagcgaaaggattagggcacgcggtattatgtggtcgagctgtggtaggaaat
gagccttttgcagtggtattgcctgatgtgttattggcagattttactgcagatcaaaaa
acagaaaacttagcagcaatgattcaacgtttcaaagaaacaggcaaaagccaaattatg
gttgtacctgtggcgaaagaaaatgtgagtaactatggtattgtagattgccaaggtgca
gaattacaacctgcaggtacagcgaagattgctaacatcattgaaaaaccaagtattgaa
gaagctccgtctaattttgccgttgtgggacgttatgtcttctctgcagaaatttgggat
ttacttgccaaaacaccggttggtgtgggtgatgaaattcaattaaccgatgcgattgat
atgttgattgaacaacaagaggtggatgcctttcatatgacaggtaaaaccttcgactgt
ggtgacaaattaggctatatggaagcctttgtagaatacagtttgaaccacgataaattt
ggcggtgaatttaaagattatttgaaaaaattatcgaagtcgctgtaa

DBGET integrated database retrieval system