KEGG   Glaesserella parasuis SH0165: HAPS_0491Help
Entry
HAPS_0491         CDS       T00825                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00010  Glycolysis / Gluconeogenesis
hap00020  Citrate cycle (TCA cycle)
hap00620  Pyruvate metabolism
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01120  Microbial metabolism in diverse environments
hap01130  Biosynthesis of antibiotics
hap01200  Carbon metabolism
Module
hap_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAPS_0491 (aceF)
   00020 Citrate cycle (TCA cycle)
    HAPS_0491 (aceF)
   00620 Pyruvate metabolism
    HAPS_0491 (aceF)
Enzymes [BR:hap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HAPS_0491 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H PYNP_C HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACL32156
UniProt: B8F4A4
Position
complement(529440..531065)
Genome map
AA seq 541 aa AA seqDB search
MSKQIQIPDIGGDEVTVTEVMVKVGDTIAADQSIINVEGDKASMEVPAPEAGVVKEVLVK
VGDKVTTGSPMLVLEAAGSALAPQAVAEAAPAPAAAPIASAVVDVNVPDIGGDEVNVTEI
MVKVGDTVAVDQSIINVEGDKASMEVPAPIAGVVKEILVKVGDKVSTGSLIMKFEVAGAA
PAAAPAPVAAEPAPQAAAVPAPVAAAPAQSGNVSGLSQEQVVASAVYAHATPVIRRLARE
FGVNLDRVKGTGRKGRIVKEDIQAYVKTAVQVFEDVKSGKAPAAAGNGVANGAGLGLLPW
PKVDFSKFGEIEEVELSRINKISGANLHRNWVMIPHVTHFDRTDITDLENFRKEQNKLAE
KQKLDVKITPVVFIMKAVAKALEAYPRFNSSISEDGQKLTLKKYINIGVAVDTPNGLVVP
VFKNVHKKGIIELSRELMEVSKKAREGKLTAADMQGGCFTISSLGGIGTTHFTPIVNAPE
VAILGVSKSEMMPQWNGKEFEPRLMLPLSLSFDHRVIDGADGARFLSYINGVLADIRRLV
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattccagatatcggtggtgatgaagttaccgtaaccgaagtg
atggtcaaagtgggcgatactattgctgctgaccaatctattatcaatgtagaaggtgac
aaagcctctatggaagtaccagcaccagaagcaggtgtggtaaaagaagttttagtgaaa
gtgggcgataaagtgaccacaggttcaccaatgttagttttagaagcagcaggttcagca
ctagcaccacaagcggtcgcagaagctgcaccagctccagcggcagcaccgatagcgagt
gcagttgttgatgtcaatgtaccagatatcggtggcgatgaagtcaacgtgactgaaatt
atggtgaaagtgggtgatactgttgccgttgatcaatctatcatcaacgtagaaggcgat
aaagcctctatggaagtgccagcaccaatcgcaggtgtggtgaaagaaattttagtgaaa
gtcggcgataaagtttcaactggctcattaattatgaaatttgaagtcgcaggtgcagca
ccggcagctgctccagcacctgttgcagctgagccagctccacaagcagcggcagtgcct
gcaccagttgcagcagcgccagcacaatcaggtaatgtgtctggtttaagccaagaacaa
gtggttgcaagtgcagtttatgcccacgcaaccccagtgattcgtcgcttagcacgtgag
tttggcgtaaacctagatcgtgttaaaggtacaggtcgtaaaggtcgtatcgttaaagaa
gatattcaagcttacgtgaaaactgcggttcaagtatttgaagatgtgaaatcaggcaaa
gcaccggcagcggcaggtaatggcgtagcgaacggtgcaggtttaggcttattaccgtgg
ccgaaagtcgatttcagcaaatttggtgaaattgaagaagttgaattaagccgtatcaat
aagatctcaggtgcgaacttacatcgtaactgggtgatgattccacacgttacacacttt
gatcgtacggacatcaccgatttagagaatttccgtaaagaacaaaacaaactggctgaa
aaacaaaaattagatgtgaaaattacgccagtggtgttcattatgaaagcggtagcgaaa
gcgttagaagcgtacccacgtttcaacagctcaatttctgaagacggtcaaaaacttacc
cttaagaaatatattaacatcggcgttgcagtagatacaccaaacggcttagttgttcca
gtattcaaaaatgttcacaaaaaaggcatcattgagctttctcgtgaattaatggaagtg
tctaagaaagcgcgtgaaggtaaattaactgcagcagatatgcaaggcggttgtttcacc
atttcaagcttaggcggtatcggtacaacccacttcacaccaatagtgaatgcccctgaa
gttgcaattttaggcgtatcgaaatcagaaatgatgccacaatggaacggtaaagagttt
gagccacgcttaatgcttccgttatcattatctttcgaccaccgtgtaattgacggtgcg
gatggtgctcgtttcttaagctacattaacggtgtacttgcggacattcgtcgtttagta
atgtaa

DBGET integrated database retrieval system