KEGG   Haemophilus parasuis SH0165: HAPS_0540Help
Entry
HAPS_0540         CDS       T00825                                 

Definition
phage-like lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hap  Haemophilus parasuis SH0165
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
581237..581761
Genome map
AA seq 174 aa AA seqDB search
MNKNLKFGGAMVCGIGAIIGLVQLNHPEIRTSPKGLDIIGNTEGCRRDPYVCPANVLTVG
IGSTEATSGKIERKIYSDKEIADRWAKDLAEAERCVNRYANGKKMPQGAFDALTSITFNA
GCGTMRHSTLFKLANQGYSPAMCEQFSRWVYANGKKLRGLEIRREKEQALCLAL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaatcttaaattcggcggagcgatggtctgcggtatcggtgcgattatcggc
ttagtacagcttaatcaccctgaaatccgcaccagtccaaaaggcttagacattatcggc
aacactgaagggtgcagacgagatccttatgtttgccctgcgaatgtactcaccgtcggc
attggttcaaccgaagccacaagcggtaagattgaacgcaaaatttacagcgacaaagaa
attgctgaccgctgggcgaaagatttagccgaggcggaacggtgcgtaaaccgctacgcc
aacggcaaaaaaatgccacaaggagcgtttgacgcattgacatcaattaccttcaatgca
ggttgcggaacaatgcgacattcgaccttgttcaaactcgccaatcaaggttacagccct
gcaatgtgtgaacagtttagccgttgggtctatgccaatggcaaaaaactgcgtggttta
gaaatcagacgagaaaaggaacaagcactatgtttagcattataa

DBGET integrated database retrieval system