KEGG   Haemophilus parasuis SH0165: HAPS_0655Help
Entry
HAPS_0655         CDS       T00825                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (E2)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAPS_0655 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HAPS_0655 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HAPS_0655 (sucB)
Enzymes [BR:hap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HAPS_0655 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
665515..666732
Genome map
AA seq 405 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKVGDSVKRDEVIVEIETDKVVLEVPATSDGVITEIQ
QGEGATVVSKQVLGILVTQQAGDVSLATIKPVNEATPSDRQTASLEPDNSSADALGPSVR
RLLAEHGLEASEVKGSGVGGRITREDIEAVVAKRNAKVAEKVENTISTVAYSARSEKRVP
MTRLRKRIAERLLEAKNTTAMLTTFNEVDMKPIMDLRKQYGEKFEKQHGVRLGFMSFYIK
AVVEALKRYPEVNASIDGDDVVYHNYFDVSIAVSTPRGLVTPVLRDCDKLSMADIEKAIK
ALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPVAVDG
QVVIRPMMYLALSYDHRLIDGRESVGFLVAIKDLLEDPTRLLLEI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaatcctcgttccagatttacccgaatccgttgcagatgcgaccgttgca
acttggcataaaaaagttggcgatagcgtaaaacgtgatgaagttattgtagaaattgaa
accgataaagtggttctcgaagtgcctgcgactagcgatggtgtgattaccgaaattcaa
caaggcgaaggggcaactgttgtaagtaaacaagttttaggtattttagttactcagcaa
gcaggtgatgtgtctttagcaacaattaaaccagtaaatgaagcaaccccttcagatcgt
caaaccgcctctttagagccagataatagctcagctgacgcattaggtccaagtgttcgc
cgtttacttgcagaacacggtttagaagctagtgaggtgaaaggttcaggtgtaggtggc
agaattactcgtgaagatattgaagctgttgtggctaaacgtaatgcgaaagtggctgag
aaagttgaaaatacgatcagcacagtggcttactctgctcgtagtgaaaaacgtgtgcct
atgacccgcttgcgtaaacgcattgcagaacgtttattagaggcgaaaaatactacggcg
atgctcaccacattcaatgaagtagatatgaagccgattatggatctgcgtaagcaatac
ggtgaaaaatttgaaaaacaacacggtgtgcgtttaggctttatgtcgttctatatcaaa
gcagtggtggaagcattgaaacgttatcccgaagtgaatgcttctattgatggcgatgat
gtggtgtatcacaactattttgatgtcagtatcgctgtttctacccctcgtggtttagtt
acccctgtgttacgcgattgcgacaaactttcaatggcagacattgaaaaagccattaaa
gcactggcagaaaaaggacgcgatggcaaattgactgtagaagacttgacaggtggaaac
ttcactatcactaatggcggtgtctttggttcattaatgtccacgccgattatcaatcca
ccgcaaagtgctattttaggtatgcatgctattaaagatcgccctgtggctgtagacggt
caggtggttattcgtccgatgatgtatcttgcattgagctatgatcaccgtttgattgat
ggacgagagtctgttggtttcttagtagccatcaaagatttactcgaagatccaacacgt
ttgttgttagaaatttag

DBGET integrated database retrieval system