KEGG   Glaesserella parasuis SH0165: HAPS_0676Help
Entry
HAPS_0676         CDS       T00825                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00071  Fatty acid degradation
hap00280  Valine, leucine and isoleucine degradation
hap00281  Geraniol degradation
hap00310  Lysine degradation
hap00362  Benzoate degradation
hap00380  Tryptophan metabolism
hap00410  beta-Alanine metabolism
hap00640  Propanoate metabolism
hap00650  Butanoate metabolism
hap00903  Limonene and pinene degradation
hap00930  Caprolactam degradation
hap01040  Biosynthesis of unsaturated fatty acids
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01120  Microbial metabolism in diverse environments
hap01130  Biosynthesis of antibiotics
hap01200  Carbon metabolism
hap01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HAPS_0676 (fadJ)
   00650 Butanoate metabolism
    HAPS_0676 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    HAPS_0676 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    HAPS_0676 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HAPS_0676 (fadJ)
   00310 Lysine degradation
    HAPS_0676 (fadJ)
   00380 Tryptophan metabolism
    HAPS_0676 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HAPS_0676 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HAPS_0676 (fadJ)
   00281 Geraniol degradation
    HAPS_0676 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HAPS_0676 (fadJ)
   00930 Caprolactam degradation
    HAPS_0676 (fadJ)
Enzymes [BR:hap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HAPS_0676 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HAPS_0676 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HAPS_0676 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DGOK Enkurin
Motif
Other DBs
NCBI-ProteinID: ACL32324
UniProt: B8F4S2
Position
complement(687702..689822)
Genome map
AA seq 706 aa AA seqDB search
MTTQAQYISPFHVEIDDNRIAIVRIDVKGKSQNWLPEQFIEDLRDVIGSVIYQQARGVIF
VSGKEKGFIQGYDPDHLRGKNDEQLKTLSHNAQLVMREINTLKMPAVAVIDGGCYGVGLE
LALACDYRIASEEGYTKFAMPQIRSGILPFAGGTQRLPRLVGLQNAVTMLLSGQKIGVEK
ALKIGLVDKLIPASNLFETAYQLLLNHKVQKVDHKNPLDKVKKWRKQLEGNKFIREKYLA
HIENRVWDKAFGNYPAVTEMLALLKEPHFKAGLALEQNALVKLMHTEQAQVLMNLKQTER
AMKEQYQHLAQVRDVQQVTVLGSGYMGAGIAYLTANNAQIPVRIKDIHPSEIQKALQTCY
GLMQKAVDKKQLSHGEMIQRMNLITGGERLVAAKSTDFIVEAVYEKLELKQQMVQESENY
YEENAIFATNTSTFAIRDIASVAKRPENVIGFHYFSPVTKRPMVEIIPHEKTCQRAVSTA
IHFAIQQGKIPMLVADKEGFFINRILTPFLLEAIECLSEGEGIEFIDRALQEFGFKIGPL
AMIDEIGLDIIVKSNPAMVSELGKRFALPTTIERLTGDDRKGRKNKRGFYLYDTRGKRTQ
EDKSVYHTMETIMQNEMEAEDIARRCVLRMLNEACWCLQDQVIRSTDEGNVASVFGVDFP
DFRGGVYAYIDKIGAKELVRQLRKHTQQYGERFTPCEWLVERAEKA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaagcacaatatatctcaccttttcacgttgagattgatgataatcgaatt
gccattgttcgtattgatgtaaaagggaaatcgcaaaactggttgcctgagcagtttatt
gaagatttacgcgatgtgattggttctgtgatttatcaacaagcacggggcgtgattttt
gtttcgggtaaggagaaaggttttattcaaggttatgatcctgatcatttgcgtggtaaa
aatgatgaacagctgaaaaccttatctcataatgctcagttggtgatgcgtgaaattaat
acgctcaaaatgcctgcggtggcggtgattgatggtggctgttatggcgttgggctagag
ttggcattggcgtgcgattatcgtattgccagcgaggaaggttataccaaatttgcaatg
ccacaaattcgttcggggattttgccttttgctgggggaacacagcgtttgcctcgtttg
gtcggcttgcaaaatgcggtcacgatgttgctatctggacagaaaattggggtggaaaaa
gccctgaaaattgggctggtggataaacttatccctgccagtaatttatttgaaacggca
tatcagttattgcttaaccataaagtgcaaaaagtggatcataaaaatccgcttgataag
gtcaaaaaatggcgtaaacagcttgagggcaataagtttatccgtgaaaaatatctggct
catattgaaaatcgtgtttgggataaagcctttggcaactatcctgcggttacagagatg
ttggcattattgaaagagcctcattttaaagccgggttggcattagaacaaaatgcgtta
gtgaagttaatgcacacggagcaagctcaggttttaatgaatttgaaacagactgagcga
gcgatgaaggagcaatatcaacacttggctcaagtgcgagatgtacaacaagtgacggtg
ctgggtagtggttatatgggggctgggattgcttatttgacggcaaataatgctcaaatt
ccagttagaattaaggatattcacccgtcggaaattcaaaaagcattgcaaacttgctat
ggcttaatgcaaaaagcggtggataagaaacagctcagccacggtgagatgatccaacga
atgaatttaattacgggtggtgagcgtttagttgcggcgaaatcgacagattttatcgta
gaggcagtttatgaaaaattagaactcaaacagcagatggtgcaagaaagtgaaaattac
tacgaagaaaatgcgatttttgccacaaatacctcaacctttgcgatccgtgatattgct
tctgtcgccaaacgccctgaaaatgtaatcggttttcactatttcagccctgtgactaaa
cgtccgatggtggaaattattccacacgaaaaaacttgccagcgagcggtttcaacggca
attcattttgcgatccagcaaggaaaaattccgatgcttgttgcggataaagaagggttc
tttattaaccgtattcttacgccgttcttacttgaagcaatcgagtgtttatccgaaggg
gaagggatcgaatttatcgaccgtgccttacaggaatttggctttaagatcggaccgctt
gcaatgatcgatgaaattggcttggatattattgttaaatctaatccagcgatggtgagt
gaattgggtaaacgttttgctttaccgacgactattgagcgtttgactggcgatgatcgt
aaagggcgaaaaaataaacggggcttctatctctacgacacaagaggaaaacgcactcaa
gaggataagagtgtttatcacacaatggaaaccattatgcaaaatgaaatggaagccgaa
gatattgcccgtcgttgtgtattgagaatgttgaatgaagcctgctggtgtttacaagat
caagttattcgttccaccgatgaaggtaacgttgcttctgtatttggggtggatttccca
gatttccgaggcggtgtgtatgcctatattgacaagattggggctaaagagcttgttcgt
cagttacgcaaacatacacaacaatatggcgagcgttttacgccttgtgagtggttggta
gaaagggcggaaaaggcataa

DBGET integrated database retrieval system