KEGG   Haemophilus parasuis SH0165: HAPS_0682Help
Entry
HAPS_0682         CDS       T00825                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hap  Haemophilus parasuis SH0165
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hap00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hap00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(696084..696581)
Genome map
AA seq 165 aa AA seqDB search
MKISVIVARTLNKVIGKDNAMLWHLPVDLAWFRENTLGKPVIMGRKTYESIGRLLPKRPN
IILSRSGFAIDGAYSAISLEQAVELAKNFANSDEIMILGGGELFKQTMPFADKLYLTEIQ
ANIEGDTFFEFDETQWQQIAEKWSEIDEQNSYRCRFMILDKLKND
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagcgtaatcgtagctcgaactttaaataaagtgatcggaaaagacaatgca
atgctgtggcatttgcctgtggatttggcgtggtttagggaaaatactttgggtaaacct
gtgattatggggcgaaaaacctatgaatctatcggtaggctgttgccgaaacgcccgaat
attattctttctcgctctggttttgctattgatggagcttattctgcaataagccttgaa
caagcggtggaattagccaaaaattttgctaatagcgatgaaataatgattctcggcggt
ggtgagttattcaaacaaacaatgccttttgccgataaactttatcttactgaaattcaa
gccaatatagagggcgatactttttttgagtttgatgaaactcagtggcaacagattgca
gagaagtggtctgaaatagatgagcaaaatagttaccgttgtcggtttatgattttggat
aagttaaaaaatgattaa

DBGET integrated database retrieval system