KEGG   Haemophilus parasuis SH0165: HAPS_0683Help
Entry
HAPS_0683         CDS       T00825                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAPS_0683 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HAPS_0683 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HAPS_0683 (proB)
Enzymes [BR:hap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HAPS_0683 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696664..697764
Genome map
AA seq 366 aa AA seqDB search
MAKTIVVKLGTSTLTHGTKSLSRPHMLEIVKQVAQLHEQGHRIIIVTSGAVAAGRDYLGH
RELPKTLATKQLLAAVGQSQLIQVWESLFSIYNIKIGQMLLTRADIENKDHFLNARDTLT
ALLDQQIIPIINENDAVATAEFRIGDNDNLSALVAILSQAELLILLTDQEGLYDSDPRSN
PNAKRIPVVEKITPEIRQMAGGSGTTLGTGGMSTKITAADIATRSGVETAIASGERPNVI
FEVAQGTEIGTRFLAQHDKIEGRKQWLFGAPPAGTIYIDQGAENALVEQHKSLLPTGIAK
IEGQFARGEVAKICNLNGKVLALGISRYNSDALALIKGKKSSEIETILGYEFGSVVFHRD
EMVVHY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacaatcgtagtaaaactaggcactagcaccctaacccacggcactaaaagt
ctaagccgtccacatatgctagaaatcgtaaaacaagttgctcaactacacgaacaagga
catcgcattattattgtaacctctggggcggttgccgctgggcgtgattacttagggcat
cgtgaattgccaaaaacgttggcaaccaaacagcttctagccgcagtcggacaaagccag
cttattcaagtgtgggaaagcctcttttccatttataacatcaaaatcgggcaaatgctt
ttaacccgtgcagatattgaaaataaagatcactttttaaatgcaagagatacgctcacc
gccttgctcgatcaacaaattatcccgattatcaatgaaaatgatgcagtggcaacggca
gagtttcgtatcggcgataacgataatttatcggcactcgtagcaattttatctcaagca
gagttattgattttgctcaccgatcaagaagggttatacgacagtgatccacgttcaaac
ccaaatgccaaacgcattcctgttgttgaaaaaatcacccctgaaattcgccaaatggca
gggggaagtggtacaaccttaggcacaggcggtatgagtaccaaaatcaccgctgccgat
attgccacccgttctggcgttgaaacagcgattgcttctggcgaacgtcctaatgtgatt
tttgaagtggcacaaggaacggaaattggcacacgcttcttagctcaacacgacaaaatc
gaaggacgcaaacagtggctctttggtgcgccgcctgctggcacaatttatatcgatcaa
ggggcagaaaacgcattagtagaacagcataaatcgctcttacctactggtattgccaaa
atcgaagggcaatttgcgcgtggtgaagtggcaaaaatttgtaaccttaacggcaaagtg
cttgcccttggcattagtcgttataacagtgatgctctagcattaatcaaaggcaaaaaa
tctagcgagattgaaaccattttgggctatgaatttggttcagtagtattccaccgagat
gaaatggtggtgcattattaa

DBGET integrated database retrieval system