KEGG   Glaesserella parasuis SH0165: HAPS_0729Help
Entry
HAPS_0729         CDS       T00825                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00900  Terpenoid backbone biosynthesis
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HAPS_0729 (dxr)
Enzymes [BR:hap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HAPS_0729 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Toprim_3 NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACL32374
UniProt: B8F4X2
Position
complement(740823..742013)
Genome map
AA seq 396 aa AA seqDB search
MQKLVILGSTGSIGKSTLSVVDNNPEQYQVFALVGGKNVELITEQCQQYQPRFVALDDEQ
AAAKLKENLTALGLKIEVLAGQKAIYELASHPEVDMVMAAIVGAAGLLPTLSAVQAGKKV
LLANKESLVTCGQIFIDEARKSGAKLLPVDSEHNAIFQSLPPEAQEKVGFCPLAELGVSK
IILTGSGGPFCTKPLNEFSQITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFN
ASADEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMRTPIAHTMAYPNRIYAGVAPLDFF
KLKELTFIEPDFARYPNLKLAIEAFAEGQYATTAMNAANEIAVEAFLNDQIRFTDIVEVN
RQVVENIAPVQVKEIADVLHIDKLAREVAKQHILQF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattagtcattttaggttcaacaggctctatcggaaaaagcaccctttctgtg
gtcgataataaccctgagcagtatcaagttttcgctttagttggcggaaaaaacgtcgaa
ttaattaccgaacaatgccaacaatatcaaccgcgtttcgtggcattagatgatgaacag
gcagctgcaaaattaaaagaaaatctcaccgctttaggattgaaaatcgaagttctcgca
gggcaaaaagcgatttacgaactggcttcacaccctgaagtggatatggtaatggcggca
attgtgggcgcggcaggcttattaccgacgctctcagcggtgcaagcaggcaaaaaagtc
ttgctggcaaataaagaatcattggtcacttgcggacaaatttttattgatgaagctcgc
aagtcaggtgctaaattgctccctgtcgatagtgaacataacgccatttttcaatcattg
ccgccagaagcacaagaaaaagtaggtttctgcccgcttgcagaactaggggtaagtaaa
attattctcacgggttcaggcggccctttctgtacaaaaccattgaatgaatttagtcaa
attaccccagctcaagctgtcgcacacccgaattggtctatgggtaaaaagatttcggtg
gactctgccacaatgatgaacaaagggttggaatacattgaggctcgttggctctttaat
gcctcagctgatgaaatggagatcatcattcacccacaatctatcattcactcaatggta
cgttacattgacggtagcgtcattgcacaaatgggcaatcctgatatgcgaaccccgatt
gctcacacaatggcatatccaaaccgtatctacgctggcgttgctccattagatttcttt
aaattaaaagaactcacctttattgaacctgattttgctcgttaccctaacttaaaattg
gcgatagaggcttttgccgagggacaatatgctacaacggcaatgaatgcagcaaatgaa
attgcagtagaggcatttttaaacgatcaaatccgttttacagatattgtcgaagttaat
cgtcaagttgtcgaaaatattgcccctgttcaagttaaagaaattgccgatgttctacat
attgataaattggcaagagaggtggcgaagcaacatattttacaattttaa

DBGET integrated database retrieval system