KEGG   Glaesserella parasuis SH0165: HAPS_0739Help
Entry
HAPS_0739         CDS       T00825                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00520  Amino sugar and nucleotide sugar metabolism
hap00550  Peptidoglycan biosynthesis
hap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HAPS_0739 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HAPS_0739 (murA)
Enzymes [BR:hap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HAPS_0739 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:hap01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   HAPS_0739 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase DUF520 PepSY_2
Motif
Other DBs
NCBI-ProteinID: ACL32383
UniProt: B8F4Y1
Position
complement(752203..753477)
Genome map
AA seq 424 aa AA seqDB search
MEKFRVHGPFTLSGTVDISGAKNAALPILFAAILAEEPVILTNVPNLKDVETTVKILRKL
GVVVERAENNAVHIDASKIDHYVAPYELVKTMRASIWALAPLVARFHQGQVSLPGGCTIG
ARPVDMHIAGLEKMGATITLDEGYVKAEVNGRLTGARILMDKVSVGATLSVMMAATLAKG
TTTIENAAREPEIVDTAIFLNKMGAKITGAGTDTITIEGVERLGGCEHHIVPDRIETGTF
LVAAAISGGRITCRGTKADTLDAVIEKLREAGMQVDVTENSITLDSLGMRPKAVNIRTMP
HPGFPTDMQAQFTLLNVVANGTSKITETIFENRFMHIPELIRMGAKAEIEGNTAICHGVE
NLSGAEVMATDLRASISLVLAGCIANGQTIVDRIYHIDRGYEHIEDKLQKLGARIERFNA
PFEE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttcgtgttcacggtcctttcactttaagcggaactgttgatatttcaggt
gccaaaaatgcagcattaccgattttatttgcggctattttagcggaagaacccgttatt
ttaacgaacgtccctaacttaaaagatgtcgaaaccaccgtcaagattctacgcaaacta
ggtgttgtcgttgaacgtgcagaaaataacgcagtacatattgatgccagcaaaatcgac
cattatgttgcaccttatgaacttgtcaaaacaatgcgagcttcaatttgggcattagcc
cctcttgtggctcgtttccatcaaggtcaagtttcattaccaggtggctgtaccatcggg
gctagacctgtcgatatgcacattgcaggcttagaaaaaatgggtgcgactatcaccctt
gatgaaggttacgttaaagcagaagtgaacggtcgcttaacaggggctcgtattctgatg
gataaagttagcgttggtgcaacattatctgtgatgatggcggcaacccttgcaaaaggc
acaaccactattgaaaatgccgctcgtgaacctgaaattgttgatactgctattttcctc
aacaaaatgggggcaaaaattacaggggcaggtacagacacaatcacaattgagggggta
gagcgtttaggtggctgtgaacaccacattgtcccagatcgtatcgaaacgggtacattc
cttgttgctgccgcaatctctggcggacgaattacttgtcgaggcacgaaagcggataca
ttagatgccgtaattgaaaaattgcgtgaagcaggaatgcaagtggacgtgaccgaaaac
agcattaccctcgactcgctaggtatgcgaccaaaagcagtcaatatccgcacaatgcct
cacccaggcttcccaacggatatgcaggcccagtttacactattaaatgtcgttgcaaat
ggcaccagcaaaattaccgaaacgatctttgaaaaccgctttatgcacattccagagcta
atccgtatgggagcaaaagcagaaattgaaggtaacacagcgatctgtcacggtgtcgaa
aacctttcaggcgcagaagtaatggcaacagacctacgagcttctatcagtttagttctg
gcaggttgtattgcaaatggtcaaactattgttgatcgtatttatcatatcgaccgtgga
tatgaacacattgaagataaactacaaaaattaggtgctagaattgaaagatttaatgca
ccatttgaagaataa

DBGET integrated database retrieval system