KEGG   Glaesserella parasuis SH0165: HAPS_0796Help
Entry
HAPS_0796         CDS       T00825                                 

Gene name
yeaD
Definition
(GenBank) aldose 1-epimerase-like protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00010  Glycolysis / Gluconeogenesis
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01120  Microbial metabolism in diverse environments
hap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAPS_0796 (yeaD)
Enzymes [BR:hap01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     HAPS_0796 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim SSL_OB
Motif
Other DBs
NCBI-ProteinID: ACL32432
UniProt: B8F530
Position
complement(800033..800836)
Genome map
AA seq 267 aa AA seqDB search
MTKQLTPELVLVDYNQIPVLEITHPKVKAKVALQGAHLLSWQPVHAEQDVFWLSEVEPFE
QGNAIRGGVPICYPWFGGVKQPPHGTARNRLWELSHYQVQADQVKLEFSLFDENQQLEAK
MEMELGLTCQLRFTHLAQGEAQVALHSYFNVKNIEQVELFGLPEQTFNSLIQQQQAVSSP
RKIAELVDEIYRANQQPTLIQDLGYSRQIMVEHQNASEVVVWNPWHKAMSGMSETGYRTM
VCVETARIYQLVQSGEQVSVKISVKSL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaacttaccccagagcttgtattggtcgattacaaccaaattccagtgctt
gaaattactcacccgaaagtgaaagcgaaggtggctttacaaggtgcgcatttattgagc
tggcaacctgttcacgctgagcaagatgttttttggctcagtgaagttgagccgtttgag
caaggcaatgctattcgtggtggcgtgccgatttgttatccgtggtttggtggtgtaaaa
caacccccacacggtaccgctcgtaatcgcttgtgggagctatctcactatcaagttcaa
gcggatcaggtcaaacttgaatttagtctgtttgatgaaaatcagcaattagaagccaaa
atggagatggaactaggactaacttgccagttgcgttttacccatttagctcaaggcgaa
gcacaagtggcattacatagttattttaatgtcaaaaacattgagcaggtggaattgttt
ggcttaccagaacagacctttaattcccttattcagcaacagcaagcggttagttcgcca
cgcaaaattgcagaattagttgatgagatttatcgtgctaaccaacaaccaacgctgatc
caagatcttggctattcccgtcaaattatggttgaacatcaaaatgccagcgaagtggtg
gtttggaacccgtggcataaggcaatgagcggaatgagtgaaacgggatatcgaacgatg
gtttgcgttgaaactgcacggatttatcaattagtgcaatcaggtgaacaagttagcgtg
aagattagcgtcaaatccctgtaa

DBGET integrated database retrieval system