KEGG   Haemophilus parasuis SH0165: HAPS_0839Help
Entry
HAPS_0839         CDS       T00825                                 

Gene name
cysQ
Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HAPS_0839 (cysQ)
Enzymes [BR:hap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HAPS_0839 (cysQ)
Transfer RNA biogenesis [BR:hap03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HAPS_0839 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(838523..839335)
Genome map
AA seq 270 aa AA seqDB search
MQTLTQQLLNDVLNIATQAGEHLKRFYHRSVEIQIKADKTPVTEADLFISQFVIEQLQKL
TPNVPILSEESCKIPLSERSQWQEYWIVDPLDGTQQFIDRTDQFSVVIGLVQQNRPVLGV
IHSPILDKTYYAMRASGAFVRENDEIRRLNSNSQNDDKSHRLQVTIGTSSSDKIRQVVLP
PYQVDFLQFGSSSLKAGLVAEGKADCYVRLGDTGEWDTAVAEVLLAETGGQVFDLHFQPL
SYNQRETFVNPYFIMVANKQRDWQQIFSFN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacttactcaacaactattaaatgatgtccttaatattgccactcaagcagga
gagcatctcaaacgcttttatcatcgttctgtggaaattcagattaaagcagataaaacc
cctgtgactgaagctgatctttttattagccagtttgtgattgaacaattacagaaattg
accccaaatgtgccgatcttgtcagaagagagttgtaaaattccactttcggagcgttcg
caatggcaagagtattggatcgttgatccgcttgatgggacacagcaatttattgataga
accgatcaattttcggttgtgattgggttagttcaacaaaatcgtcctgttctgggggtt
attcattcgccgatcttagacaaaacctactacgcaatgcgtgcaagcggtgcttttgtt
agagaaaatgacgagatccgtcgtcttaattcgaatagtcaaaatgacgataaatcacac
cgcttgcaagtgactattggtacgtcaagtagcgacaaaattcgccaagttgtgcttccc
ccttatcaagtggattttcttcaattcggttcaagtagcttaaaagctgggttggttgct
gaaggtaaggcggattgctatgtgcgtttaggggatactggagaatgggatacggctgtt
gctgaagtgttactcgcagaaacaggcggtcaggtctttgatcttcacttccaaccgtta
agctataatcaacgtgaaacctttgtaaacccttattttataatggtggcaaataaacaa
cgtgattggcaacagattttttcttttaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system