KEGG   Haemophilus parasuis SH0165: HAPS_0946Help
Entry
HAPS_0946         CDS       T00825                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hap00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928597..929376
Genome map
AA seq 259 aa AA seqDB search
MGILNFTPDSFSDSGKFFTLDKALFQVEKMLNDGADIIDIGGESTRSNAEIVTLEQELER
VVPLVEAVRKRFDCLISVDSSKAEVFRQSAQVGADILNDIRALQEPNALETAVELGLPVC
LMHMQGTPQNMQQNPEYNDVVEEVADFLNQRIFACTMAGIPKEHIILDVGFGFGKTVQHN
YQLLKHLNAFVASGYPVLAGLSRKSMIGNVINKPVDQRVAGSVAGALLAVQNGAKIVRVH
DVAETVDALKVWQAMNECE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggggattttgaattttacccctgattcgttctccgattcgggcaaattttttaccctt
gataaagccctgtttcaagtggagaaaatgctcaatgacggggcggatattattgatatt
ggtggtgagtccacccgttcgaatgcagaaattgttacccttgagcaagagttggaacgg
gttgtgccgttggttgaagcggttcgcaagcggtttgattgtttgatttcggtagatagc
tcaaaggcggaagtatttcgtcaatctgcacaagttggggcggatattctcaatgatatt
cgtgcgttacaagagccgaatgccttagaaactgccgtagaattaggtttgcctgtttgt
ttaatgcatatgcaaggcacaccgcaaaatatgcaacaaaatcctgaatataatgatgtg
gtggaagaagtcgcagattttctcaaccaacgcatttttgcttgcacaatggcaggcatt
cccaaagagcatattattttagatgtcggctttggttttggtaaaacggtacaacataat
tatcaactgctaaaacatctaaatgcctttgtagcttcgggctatcctgtgttagctggg
ctttcccgtaagtcgatgatcggcaatgtaatcaataaaccagtcgatcaacgtgtagca
ggcagtgtcgcaggggcattgctcgcagtgcaaaatggagcgaagatcgtgcgagttcac
gatgtagcagaaaccgttgacgccttgaaagtgtggcaagcgatgaatgaatgtgaataa

DBGET integrated database retrieval system