KEGG   Haemophilus parasuis SH0165: HAPS_1005Help
Entry
HAPS_1005         CDS       T00825                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HAPS_1005 (hemD)
Enzymes [BR:hap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HAPS_1005 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(998818..999576)
Genome map
AA seq 252 aa AA seqDB search
MNVLVTRPDQRGLQLVEMLAEQQIFAIHQPLFRVEAGADLPTLPSSLSRLNSGDYVFAVS
KNAVDFATETLKQTGFYWRSDLLYFAVGQRSANHFASQIEQAVRYPIQSENSEGLLALPE
MAQLSGKNVLILRADTGREFFAEQATSRGAEVQILECYRRIMLADNLSEQISLAKRAGTD
TIVVTSGEILTTFIEQTAEADLPWLYQCRLIVVGKRIATLARKSGWKSEQIQISMKADNH
SLLETILNCVKF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttttagtcacacgccccgatcaacgtgggctacaattagttgaaatgttggca
gaacagcaaatttttgccattcatcaaccgctgtttcgagttgaagcaggggcggatctg
ccaacgttgccaagcagtttatctcgtttaaattcgggtgattatgtttttgccgtgtca
aaaaatgccgttgattttgcaactgaaaccttaaagcaaacgggattttactggcgaagt
gatttactctattttgccgttgggcaacgttcagcaaaccatttcgcttcccaaattgaa
caagcggtacgttaccctattcaatcagaaaacagtgaagggctactggcattgccggaa
atggctcagttgtctggaaaaaatgtgctgattttacgcgcagatacagggcgagaattt
tttgctgaacaagcaacttcacgaggtgctgaagtgcagatcctcgaatgttatcgccgt
ataatgttggcggacaatttaagcgagcagataagcctcgcaaaacgagcaggaacagat
accattgtcgtgacaagcggtgagattttaaccacgtttatcgaacagaccgcagaagcg
gatctgccttggctctaccaatgtcgtttaattgtggttggcaaacgtatcgccacactt
gcccgaaaatcaggctggaaaagcgaacaaattcaaatttcaatgaaagcggataatcat
agtctgctggaaacaatactcaactgtgtgaaattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system