KEGG   Haemophilus parasuis SH0165: HAPS_1013Help
Entry
HAPS_1013         CDS       T00825                                 

Gene name
nagZ
Definition
(RefSeq) beta-hexosaminidase
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HAPS_1013 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    HAPS_1013 (nagZ)
Enzymes [BR:hap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HAPS_1013 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1011797..1012819)
Genome map
AA seq 340 aa AA seqDB search
MLLIDLAGYELTQEEQELLEHPLVSGLILFTRNFHDKAQLQALIKSVRQRVKKPLLITVD
QEGGRVQRFREGFTKLPAMQSFLQLDRLQLAQEAGWLMSAEMFALDIDLSFAPVLDLGHC
SKAIGDRSFGEDVATMLPVAEAFIDGMREIGMAATGKHFPGHGHVIADSHLETPFDDRPK
ETIFNHDIQPFKQLIAKGKLSAIMPAHVIYTQCDSQPASGSSYWLKEILRKQLQFNGVIF
SDDLGMKGAGFMGNYVERSEKALQAGCDLLLLCNEPDGVVQVLDNLKYQPTPTQKERYLS
LMKRKQISWSELTASPRWQQAHQQLATLQDQWLEWKAQNA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctacttatcgatcttgctggctacgaacttactcaagaagaacaagagttactcgaa
cacccactggtttcaggacttattctctttacacgcaattttcacgataaagcccagttg
caagccctcattaaatctgtccgccaacgagtgaaaaagccattattaatcaccgtcgat
caagaaggcggtcgagtgcaacgtttccgtgaaggatttaccaaattgcctgcaatgcaa
tcttttttacaattagaccgcttgcaactagcccaagaagctggctggctaatgtccgca
gaaatgtttgcgttagatattgatttaagttttgcccctgtgttggatctcgggcattgt
agcaaggcaatcggcgatcgctcgtttggggaagatgtagccacaatgctacctgtcgct
gaagcctttattgacggtatgcgagaaatcggtatggcagccacaggcaaacatttccca
ggtcacggtcacgttattgctgactctcatcttgaaacgccctttgatgatcgcccaaaa
gaaacgatcttcaatcacgacattcagccgtttaaacagctgatcgccaaaggaaaatta
tcggcgattatgcctgctcacgttatttacacccaatgtgacagccaacctgctagtggt
tcaagttactggctaaaagagattttacgcaaacagttacaatttaatggcgtgatcttc
tctgatgatttaggaatgaaaggggctggttttatggggaactatgtggaacgaagcgag
aaagccttacaagcaggttgtgatttattactactctgcaatgagcctgacggtgtggtg
caagtgttagataatttgaaatatcaacctaccccaacacagaaagaacgctacttaagc
ctaatgaaacggaagcaaattagctggtcggaattaaccgccagcccacgttggcaacag
gctcatcaacaacttgctacacttcaagatcaatggttggaatggaaagcccaaaatgcc
taa

DBGET integrated database retrieval system