KEGG   Haemophilus parasuis SH0165: HAPS_1041Help
Entry
HAPS_1041         CDS       T00825                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hap  Haemophilus parasuis SH0165
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HAPS_1041 (recR)
DNA repair and recombination proteins [BR:hap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HAPS_1041 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1036494..1037099
Genome map
AA seq 201 aa AA seqDB search
MQSSPLLENLMEALRVLPGVGPKSAQRMAYHLLQRNRSGGVNLAKALSEAMTHIGHCKSC
RTFTEEDECAICQNYRRQISGQLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLEEESFQEVILATNPTIEGDATANYIAEMCSIHNIKVTRIAHGIPVGSE
LEMVDGTSLSHSFVGRRDISL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtagccctttacttgaaaatcttatggaagccctgcgtgtattgcctggagtc
ggcccaaaatctgcacaacgtatggcgtatcatcttttacagcgtaaccgctcaggcggt
gtgaatttagctaaagcattgagcgaagcaatgactcacattggacattgcaaatcttgc
cgaacttttactgaagaagatgagtgtgctatctgccaaaactaccgccgccaaatcagc
ggacaactttgtgtggttgaaatgcctgcagatattcaagcgattgaacaaactgggcaa
ttttcagggcgttatttcgtattaatgggacatctatctcctttagatggaatagggcct
cgtgaaattggtttagatttattacagaaacgcttagaagaagaatcttttcaagaagtg
attctggcaaccaatccaacgattgagggggatgcgaccgcaaattatatcgctgagatg
tgttctattcacaatattaaagttactcgtattgcacacggtattcctgtcggaagtgaa
ttagaaatggttgacggaacaagcctttctcattcatttgtaggaagacgggatatttct
ttataa

DBGET integrated database retrieval system