KEGG   Haemophilus parasuis SH0165: HAPS_1057Help
Entry
HAPS_1057         CDS       T00825                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HAPS_1057 (glpK)
Enzymes [BR:hap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HAPS_1057 (glpK)
Exosome [BR:hap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HAPS_1057 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1050129..1051637)
Genome map
AA seq 502 aa AA seqDB search
MTKEYIIALDQGTTSSRAVLLDKNANIVEVAQREFTQIYPQAGWVEHNPMEIWASQSSTL
NEVVAKAGVKADQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTSDFCEKLKAEGH
ADYIRKTTGLVVDPYFSGTKVKWILDNVEGARERAKKGELLFGTVDTWLVWKLTQGRSHV
TDYTNASRTMLFNIHTKQWDDKMLELLDVPREMLPEVKNSSEIYGQTNIGGMGGVRIPVA
GIAGDQQAALYGHLCVESGQAKNTYGTGCFMLMNTGDQAVESKNGLLTTIACNAKGEPCY
ALEGSIFMAGASIQWLRDELKIIHDARDSEYFATKVSSTNGVYVVPAFTGLGAPYWDPYA
RGAIVGLSRGANRNHIVRATLESIAYQTREVLDAMQADSGAKLETLRVDGGAVANNFLMQ
FQADILNAKVERPRVLEVTALGAAYLAGLATGFWSSLEELRGKAEIERTFSPDSDEEKRA
KRYKGWKRAVKRSLEWAKEDAE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaatacatcattgccttagaccaaggtacaacaagctctcgtgcggtgtta
ttagacaaaaatgcaaacattgttgaagtggctcaacgtgaatttactcaaatttatccg
caagcgggttgggttgaacataacccgatggaaatttgggcaagccaaagttcaacttta
aacgaagtcgttgcaaaagctggggtaaaagccgatcaaattgcggctattggtattacc
aaccaacgtgaaaccactattgtttgggaaaaagaaacaggtaaaccgatttacaatgcg
attgtatggcaatgtcgccgtacatctgatttctgtgaaaaattaaaagcagaaggtcac
gccgactatattcgtaaaacaacaggtttagtggttgacccgtacttctcaggcacaaaa
gtgaaatggattttggataatgtagaaggtgcaagagaacgtgcgaaaaaaggcgaattg
ttattcggtacggtcgatacttggttagtctggaaattgactcaaggaagaagccacgtc
actgactacaccaacgcttctcgtacaatgttgttcaacattcacacaaaacagtgggac
gacaaaatgttggaattattagatgttccgcgtgaaatgttgcctgaagtgaaaaattct
tctgaaatttacggacaaaccaacattggcggtatgggcggcgtgcgtattcctgttgca
gggattgctggtgaccaacaagcggcactttacggacatctttgtgtcgaatctggtcaa
gcaaaaaatacttacggcacaggctgctttatgttgatgaacactggcgatcaagcggtt
gaatcgaaaaacggcttattaaccaccattgcgtgtaacgccaaaggtgaaccttgctat
gccttagaaggctcaatctttatggctggtgcttcaattcaatggttgcgtgatgaactc
aaaattatccacgacgctcgtgactcagagtactttgcaacgaaagtaagcagtacaaat
ggcgtatatgttgttcctgcgtttacaggcttaggtgcgccatattgggatccttatgcg
cgtggtgctatcgtgggcttatctcgtggtgcaaaccgtaaccacattgtgcgtgcaaca
ttagaatctatcgcttaccaaacccgtgaagtgttagacgcaatgcaagcggatagcggt
gcgaaattagaaactttacgcgtagatggcggtgcagttgcgaacaacttcttaatgcag
ttccaagcagatattctcaatgccaaagtagaacgtccgagagtgctagaagtaaccgca
cttggagccgcttaccttgcaggcttggcgacaggtttctggagcagcttggaagagtta
cgtggtaaagcagaaatcgaaagaaccttctcacctgacagcgatgaagaaaaacgtgca
aaacgctacaaaggttggaaacgcgcggtgaaacgttcattagaatgggcgaaagaagac
gctgagtag

DBGET integrated database retrieval system