KEGG   Haemophilus parasuis SH0165: HAPS_1130Help
Entry
HAPS_1130         CDS       T00825                                 

Gene name
ccp
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hap  Haemophilus parasuis SH0165
Brite
Enzymes [BR:hap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HAPS_1130 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122061..1123458
Genome map
AA seq 465 aa AA seqDB search
MKKLLLSAIALGVAGFLGVVGYLHTFDQDQAAKLLAQTNFSGKQQEVAKVFFENGCQYCH
SPNAEMPFYAKIPGVSSMMENDVATGNRFFRLDKMLEGMKDPAKLSEADLAKLETVLRND
TMPIASFVHIHWGSRPDEQEKKTVLDWIHQQRAEHFVPKNTAGVDPTRLVQPIPDALTTD
PRKVALGDQIYHDGRLSGDGTVACSNCHQLDKGGVDGLTTSTGIRGQKGGINAPTVYNAA
FNHLQFWDGRAKDLADQAKGPPLNPVEMGSHSFDEILAKFKQDHAFMQEFLAAYPELTAD
TLTDAIAEFEKTLITPNSAFDKFLKGDQNALNDAQKRGYEAFKAAKCDTCHTGTAMGGQS
FEYMGLYDDYFKTRGTPITADDHGRFSQTKDPADMHRFKVPTLRNVALTAPYMHDGSVKD
LKEAVRVMAHYQSGKTLTDQELNDITSFLEALTGEYQGKVLTRQD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactactgttatcagcaattgctttgggcgttgctggatttttaggggtggtt
gggtatttgcatacctttgaccaagaccaagcagcaaaactacttgcacaaactaatttt
agtggtaaacagcaagaagtggcgaaagtcttttttgaaaatggctgtcagtattgccac
agtcctaatgcagaaatgcctttctatgccaaaattcctggtgtaagttcaatgatggaa
aatgatgttgcaacaggcaaccgctttttccgtttggataaaatgttagaaggaatgaaa
gatcctgctaaattgtctgaagcggatctggctaaattagaaacggtgttacgcaacgat
acaatgccaattgcgagctttgttcatattcactggggttctcgccctgatgagcaagaa
aagaaaacggtgcttgactggatccatcaacagcgtgcggagcattttgttccaaaaaat
acggctggagttgatccaactcgcttagttcaacctattcctgatgcattaactacagat
ccacgcaaagttgccttaggggatcaaatctatcatgacgggcgtttatcaggcgatggc
actgtggcttgtagcaactgccaccaattagataaaggcggtgtggacggcttgactaca
tcaacaggtattcgtgggcaaaaaggcggtatcaatgccccaacggtatataacgcagcc
tttaaccacttgcaattctgggacggtcgtgcgaaagatttagcggatcaagcaaaaggc
ccaccgcttaaccctgtcgaaatgggttcacatagttttgatgaaattttagcgaaattc
aaacaagatcacgcttttatgcaagagttcttagcggcttatcctgaattaaccgcagac
actttaacagatgccattgcagaatttgagaaaacgttgatcacgccaaacagtgctttc
gacaaattcttaaaaggcgatcaaaatgccctgaatgacgcacaaaaacgtggttacgaa
gcatttaaagcggcgaaatgtgacacttgccatacaggtaccgcaatgggtggacaatcc
tttgaatatatgggcttatatgatgattatttcaaaacgcgtggcacaccaattaccgca
gacgatcacggtcgtttctcacaaaccaaagatcctgctgatatgcatcgcttcaaagta
ccaaccttgcgtaatgtggctttaaccgccccttatatgcacgacggtagcgttaaggac
ttaaaagaggctgttcgagtaatggctcactatcaaagtggtaaaaccttaaccgatcaa
gagttgaacgatattacttcattcctagaagccttaactggtgaatatcaaggtaaagta
ttaactcgtcaggattag

DBGET integrated database retrieval system