KEGG   Haemophilus parasuis SH0165: HAPS_1258Help
Entry
HAPS_1258         CDS       T00825                                 

Gene name
alaT
Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:hap01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hap01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hap00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:hap00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1235008..1236225)
Genome map
AA seq 405 aa AA seqDB search
MERFAKTDKLAHVRYDIRGPIHKEATRLEEEGHKILKLNIGNPAPFGFEAPAEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQLKGMRDLDVGDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAATTLAGGKAVHYLCDEENEWFPDIEDIKSKITPRTKAILVINPNNP
TGAVYSRQLLLDIVAIARGHNLIIFSDEIYEKIVYDGAVHHHLAPLAPDLLTVTYNGLSK
AYRVAGFRQGWMVLNGPKNQAKGFIEGLDMLASMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAHELLTKIPGISCVKPKGAMYMFPKIDTEMYGIKDDQQFVYDLLQQEK
VLLVQGSGFNWHKPDHFRVVTLPYVDQLEEAIGRLAKFLQSYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctttgcaaaaaccgataaattagctcacgtccgctacgatattcgtgggcct
atacataaggaagcgacccgtctggaagaagaaggacataagattttaaaattaaacatt
ggtaacccggccccattcggttttgaagcccctgcggaaattttagttgatgttattcgt
aacttaccaaccgctcaaggctattgcgactctaagggtttgtactctgctcgtaaggcg
attgtgcaatattatcaattaaaaggtatgcgtgatttagatgtcggtgatgtttacatt
ggtaacggcgtatctgaactcatcacaatgtcaatgcaagccttgttaaatgatggcgat
gagattttaattccgatgccagattatccactttggacagcggcgacaactcttgcgggc
ggtaaagcggttcattacctttgcgatgaagaaaatgagtggttcccagatattgaagat
attaaatcgaaaatcactccaagaaccaaagcaattttggtgattaacccgaataaccca
acgggagcagtgtatagccgtcagttattattggatattgtggcgattgcccgtggacat
aacttgattattttctcagacgaaatttacgagaaaattgtctatgacggtgcggtacat
catcatcttgcccctcttgcccctgatcttttaacggtgacttataatggtttgtcaaag
gcataccgtgtcgcaggtttccgtcaaggttggatggtgttaaacggcccgaaaaatcag
gcaaaaggctttattgaaggcttagatatgcttgcgtcaatgcgtttatgtgccaacacc
ccgatgcaacacgctattcaaacagcgttaggcggttatcaaagcattaacgaatttatc
ttaccgggtggtcgtttattggaacaacgtaataaggctcacgaattgctcaccaaaatc
cctgggattagctgtgtgaagccaaaaggggcgatgtatatgttcccgaaaattgatacg
gaaatgtacggtatcaaagacgatcagcaatttgtttacgatctgcttcagcaggaaaaa
gtattgttggttcaaggctcaggctttaactggcataaaccagaccacttccgtgtggtg
acattgccgtatgttgatcagctggaagaagcgattggacgattagcgaagtttttgcag
agttatcgtcaggattaa

DBGET integrated database retrieval system