KEGG   Haemophilus parasuis SH0165: HAPS_1346Help
Entry
HAPS_1346         CDS       T00825                                 

Gene name
ruvA
Definition
holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hap03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1328505..1329020
Genome map
AA seq 171 aa AA seqDB search
MTSFYNLPDLNEDTMIFTHLVIREDAHLLFGFVQKQERMLFRELIKTNGVGPKLALAILS
AMSVSEFMSAIEQEELAKLIKIPGIGRKTAERLLVELKGKFSTLFHHEISILQPSGNLLS
MASMSPVNEAIDALISLGYKAADAEKMVKKVNRKSESTSEQLIREALKNAL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgactagtttctataatctacctgatcttaatgaagataccatgattttcactcatctg
gtaatccgagaagatgcgcaccttttatttggatttgttcagaagcaagagcgtatgcta
tttcgtgaactaattaaaacaaacggtgtaggacctaagttagcattagctattttgtca
gcaatgtcagtttctgaatttatgtctgctatagagcaggaagaattagcaaaacttatc
aaaataccagggattggacgtaaaacggcagagcgtttgttggttgaattgaaaggaaaa
ttttcaactttatttcatcatgaaatttctattttacaaccatcaggaaatcttttatca
atggcgtctatgagcccagtaaatgaagcgattgatgctttgatttcattaggatataag
gcagcagatgctgaaaaaatggttaaaaaagtaaacaggaaatctgaatcaacaagtgag
caacttattcgagaggctttaaaaaatgctttgtag

DBGET integrated database retrieval system