KEGG   Haemophilus parasuis SH0165: HAPS_1346Help
Entry
HAPS_1346         CDS       T00825                                 

Gene name
ruvA
Definition
holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HAPS_1346 (ruvA)
Enzymes [BR:hap01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HAPS_1346 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1328505..1329020
Genome map
AA seq 171 aa AA seqDB search
MTSFYNLPDLNEDTMIFTHLVIREDAHLLFGFVQKQERMLFRELIKTNGVGPKLALAILS
AMSVSEFMSAIEQEELAKLIKIPGIGRKTAERLLVELKGKFSTLFHHEISILQPSGNLLS
MASMSPVNEAIDALISLGYKAADAEKMVKKVNRKSESTSEQLIREALKNAL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgactagtttctataatctacctgatcttaatgaagataccatgattttcactcatctg
gtaatccgagaagatgcgcaccttttatttggatttgttcagaagcaagagcgtatgcta
tttcgtgaactaattaaaacaaacggtgtaggacctaagttagcattagctattttgtca
gcaatgtcagtttctgaatttatgtctgctatagagcaggaagaattagcaaaacttatc
aaaataccagggattggacgtaaaacggcagagcgtttgttggttgaattgaaaggaaaa
ttttcaactttatttcatcatgaaatttctattttacaaccatcaggaaatcttttatca
atggcgtctatgagcccagtaaatgaagcgattgatgctttgatttcattaggatataag
gcagcagatgctgaaaaaatggttaaaaaagtaaacaggaaatctgaatcaacaagtgag
caacttattcgagaggctttaaaaaatgctttgtag

DBGET integrated database retrieval system