KEGG   Glaesserella parasuis SH0165: HAPS_1526Help
Entry
HAPS_1526         CDS       T00825                                 

Gene name
fucI
Definition
(GenBank) L-fucose isomerase
  KO
K01818  L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00051  Fructose and mannose metabolism
hap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HAPS_1526 (fucI)
Enzymes [BR:hap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     HAPS_1526 (fucI)
    5.3.1.25  L-fucose isomerase
     HAPS_1526 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fucose_iso_N2 Fucose_iso_N1 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ACL33082
UniProt: B8F6Y0
Position
1506241..1508007
Genome map
AA seq 588 aa AA seqDB search
MTQLKSTPVKIGIRPTIDGRRLGVRESLEDQTMNMAKAVAKLISQEVRHTNGDFVECVIA
DTCIGGVFEAAACAEKFKRENVGAVITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGA
VYLAASLAGHNQMGLPAFSIYGTEVQEASDQSIPDDVREKLLRFARVGLAVATLRGKSYL
SIGSVSMGIAGSIVNQEFFQDYLGMRNEYVDMSELTRRMERGIYDKEEYELALKWANEFC
IEGVDVNAPENQMSAEEKAKLRETLVKMTIITRDLMVGNPKLAELNFGEEALGHNAIAAG
FQGQRHWTDHSPNGDFMEALLNSTYDWNGVRPPYILATENDSLNAVNMLFGNLLTGQAQI
FADVRTYWSQDSVERVTGWRPESGFIHLINSGSAALDGTGQHTDKDGKPVIKPYWEVTEE
DGKRCLENTRWCPAVYEYFRGGGLSSQYLTKGGMPFTMHRINLVKGVGPVLQIAEGWSID
LPEHVHDILNKRTNETWPTTWFVPRLTGQGAFTDVYSVMANWGANHCVATYGHVGADLIT
LASMLRIPVNMHNVADKDVFRPSAWSMFGQDKEGQDYRACANFGPLYR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgactcaactcaaatcaactccagtaaaaattggtatccgcccaaccattgatggtcgc
cgtcttggggtgcgtgaatcattagaagatcaaacaatgaatatggcgaaagcggtggcg
aagctcattagccaagaagttcgccatacaaatggggattttgtcgaatgtgtaattgcc
gatacttgtatcggtggtgtatttgaagcagctgcttgtgccgaaaaatttaaacgtgaa
aatgtgggtgcagtgattactgtgacaccttgctggtgctatggctctgaaaccattgat
atggatccgcatatgccaaaagcgatttggggctttaatggtactgaacgtccgggggca
gtttatttagctgcttcgcttgctgggcataaccaaatgggcttgcctgcgttctctatt
tatggcaccgaagtgcaagaagcaagcgatcaatctatccctgatgatgtgcgtgaaaaa
ttacttcgctttgctcgtgtaggtttagcggtagcgaccttacgcggtaaatcttatctc
tctatcggttctgtatcgatggggattgcaggctctatcgtcaatcaagaatttttccaa
gattaccttggtatgcgtaacgaatatgtcgatatgtctgaactcactcgccgtatggaa
cgtggcatttatgacaaagaagagtatgagttggcattgaaatgggcaaatgaattctgc
attgaaggtgtggatgtcaatgcgcctgaaaaccaaatgagtgcggaagagaaagctaaa
ttgcgtgaaaccttggtgaaaatgaccattatcactcgtgatttaatggtgggtaatcca
aaactggctgaactcaattttggtgaagaagccttaggtcataatgcgattgcagcaggt
ttccaaggacaacgccattggacagaccacagcccgaacggcgactttatggaagcctta
ctcaactcaacttatgactggaacggcgtgcgccctccatacattcttgcgaccgaaaat
gactcgctcaatgcagttaatatgttgttcggtaacctcttaaccggtcaagctcaaatc
tttgccgatgtgcgtacttactggagccaagactccgtagaacgtgtaacaggctggcga
ccagaaagtggctttatccacttaatcaactcaggttcagccgcattagacggtacagga
caacataccgataaagacggcaaacctgtgattaaaccgtactgggaagtgacagaagaa
gatggtaaacgctgcttagaaaatacccgttggtgtccagcggtttatgaatacttccgt
ggcggcggtttatcttcacaatatctcaccaaaggcggaatgccatttacgatgcaccgc
atcaatctcgtgaaaggtgtcggccctgtattacaaattgcggaaggttggtctatcgac
ttacctgaacacgtccacgacattctcaacaaacgaaccaacgaaacttggccaaccact
tggtttgtaccacgcttgacaggacaaggtgcattcaccgatgtttactctgtaatggca
aactggggagctaaccactgtgtagccacttacggacacgttggtgcggatttaattacc
cttgcttcaatgttgcgtattccagtcaatatgcacaacgtggcagataaagatgtgttc
cgcccaagtgcgtggagtatgttcggacaagataaagaaggtcaagattaccgtgcttgt
gcgaattttggaccgctttatcgttaa

DBGET integrated database retrieval system