KEGG   Haemophilus parasuis SH0165: HAPS_1526Help
Entry
HAPS_1526         CDS       T00825                                 

Gene name
fucI
Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hap00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1506241..1508007
Genome map
AA seq 588 aa AA seqDB search
MTQLKSTPVKIGIRPTIDGRRLGVRESLEDQTMNMAKAVAKLISQEVRHTNGDFVECVIA
DTCIGGVFEAAACAEKFKRENVGAVITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGA
VYLAASLAGHNQMGLPAFSIYGTEVQEASDQSIPDDVREKLLRFARVGLAVATLRGKSYL
SIGSVSMGIAGSIVNQEFFQDYLGMRNEYVDMSELTRRMERGIYDKEEYELALKWANEFC
IEGVDVNAPENQMSAEEKAKLRETLVKMTIITRDLMVGNPKLAELNFGEEALGHNAIAAG
FQGQRHWTDHSPNGDFMEALLNSTYDWNGVRPPYILATENDSLNAVNMLFGNLLTGQAQI
FADVRTYWSQDSVERVTGWRPESGFIHLINSGSAALDGTGQHTDKDGKPVIKPYWEVTEE
DGKRCLENTRWCPAVYEYFRGGGLSSQYLTKGGMPFTMHRINLVKGVGPVLQIAEGWSID
LPEHVHDILNKRTNETWPTTWFVPRLTGQGAFTDVYSVMANWGANHCVATYGHVGADLIT
LASMLRIPVNMHNVADKDVFRPSAWSMFGQDKEGQDYRACANFGPLYR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgactcaactcaaatcaactccagtaaaaattggtatccgcccaaccattgatggtcgc
cgtcttggggtgcgtgaatcattagaagatcaaacaatgaatatggcgaaagcggtggcg
aagctcattagccaagaagttcgccatacaaatggggattttgtcgaatgtgtaattgcc
gatacttgtatcggtggtgtatttgaagcagctgcttgtgccgaaaaatttaaacgtgaa
aatgtgggtgcagtgattactgtgacaccttgctggtgctatggctctgaaaccattgat
atggatccgcatatgccaaaagcgatttggggctttaatggtactgaacgtccgggggca
gtttatttagctgcttcgcttgctgggcataaccaaatgggcttgcctgcgttctctatt
tatggcaccgaagtgcaagaagcaagcgatcaatctatccctgatgatgtgcgtgaaaaa
ttacttcgctttgctcgtgtaggtttagcggtagcgaccttacgcggtaaatcttatctc
tctatcggttctgtatcgatggggattgcaggctctatcgtcaatcaagaatttttccaa
gattaccttggtatgcgtaacgaatatgtcgatatgtctgaactcactcgccgtatggaa
cgtggcatttatgacaaagaagagtatgagttggcattgaaatgggcaaatgaattctgc
attgaaggtgtggatgtcaatgcgcctgaaaaccaaatgagtgcggaagagaaagctaaa
ttgcgtgaaaccttggtgaaaatgaccattatcactcgtgatttaatggtgggtaatcca
aaactggctgaactcaattttggtgaagaagccttaggtcataatgcgattgcagcaggt
ttccaaggacaacgccattggacagaccacagcccgaacggcgactttatggaagcctta
ctcaactcaacttatgactggaacggcgtgcgccctccatacattcttgcgaccgaaaat
gactcgctcaatgcagttaatatgttgttcggtaacctcttaaccggtcaagctcaaatc
tttgccgatgtgcgtacttactggagccaagactccgtagaacgtgtaacaggctggcga
ccagaaagtggctttatccacttaatcaactcaggttcagccgcattagacggtacagga
caacataccgataaagacggcaaacctgtgattaaaccgtactgggaagtgacagaagaa
gatggtaaacgctgcttagaaaatacccgttggtgtccagcggtttatgaatacttccgt
ggcggcggtttatcttcacaatatctcaccaaaggcggaatgccatttacgatgcaccgc
atcaatctcgtgaaaggtgtcggccctgtattacaaattgcggaaggttggtctatcgac
ttacctgaacacgtccacgacattctcaacaaacgaaccaacgaaacttggccaaccact
tggtttgtaccacgcttgacaggacaaggtgcattcaccgatgtttactctgtaatggca
aactggggagctaaccactgtgtagccacttacggacacgttggtgcggatttaattacc
cttgcttcaatgttgcgtattccagtcaatatgcacaacgtggcagataaagatgtgttc
cgcccaagtgcgtggagtatgttcggacaagataaagaaggtcaagattaccgtgcttgt
gcgaattttggaccgctttatcgttaa

DBGET integrated database retrieval system