KEGG   Haemophilus parasuis SH0165: HAPS_1529Help
Entry
HAPS_1529         CDS       T00825                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hap00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1510254..1510907
Genome map
AA seq 217 aa AA seqDB search
MNRQTLARKIIDTCLEMTRLGLNQGTAGNISVRYQDGMLITPSGMPYEKMTEDDIVYVDN
EGNFEAGKLPSSEWQFHLAVYQTRPELNAVVHNHAINCTGVSILNKDIPAIHYMIAVTGT
NHVPCVPYATFGTWQLAEYVKQGIAKSKAILLQHHGMIAAEVNLEKALWVAHEVEVLAEW
YLKLLATTPDVPVLSDEEIKVVLGKFSTYGLRVEEKH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcaaacattagcgagaaaaattattgacacctgtttggaaatgacccgtttg
ggtttaaaccaaggcacggcaggaaacatcagtgtccgttatcaagacggtatgctgatc
accccatcaggtatgccttatgaaaaaatgacagaagacgacattgtctatgtggataac
gaaggcaattttgaagcaggaaaactgccgtcaagcgaatggcaattccaccttgccgtg
taccaaacccgcccagagttaaatgccgtggtacataaccacgctatcaactgcacaggt
gtatctatcttaaataaagatattccagctattcactatatgattgctgttacgggaaca
aatcacgttccgtgtgtaccttatgctactttcggtacttggcaacttgcggagtatgta
aaacaaggtatcgcaaaaagcaaagcgattttattacaacatcacggaatgattgctgct
gaagttaatctggaaaaagccctttgggttgctcacgaagttgaggttttagcggaatgg
tatctgaaactcttggcaacgacaccagatgtcccagtcctttctgatgaagagatcaaa
gtcgttttaggaaaattttccacttatggattgagagtggaagagaaacattaa

DBGET integrated database retrieval system