KEGG   Haemophilus parasuis SH0165: HAPS_1633Help
Entry
HAPS_1633         CDS       T00825                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HAPS_1633 (rbsK)
Enzymes [BR:hap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HAPS_1633 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611704..1612627
Genome map
AA seq 307 aa AA seqDB search
MKNKLCVLGSINVDHVIRVPYFPKAGETLTGYGYQIAYGGKGANQAVAAARCGANVHFIG
AIGDDQIGKTMKQAFEQDGINTEAISVIENQSTGLAMIQVADLGENSIVISAGANADLSE
ALVEQHKSHIEQADILLMQLESPLQAVAKAAKIAKKAGVKVVLNPAPAQPLPDSLLSQID
IITPNETEAEILTGIKVTNEQTAAVAANHFHQLGIETVLITLGSKGLFYSEKGQGEIIPG
FLVDAVDTTAAGDTFNGAFVTALLEGKSPKESIRFAHAAAAISVTRMGAQTAIPRREEIE
ALLLFSM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaactttgtgttctcggtagtatcaatgtcgatcacgttattcgagtacct
tacttccccaaagcaggtgaaaccttaacaggttacggttatcaaattgcttatggtgga
aaaggggcaaatcaagcggttgcagcggcaagatgtggtgcaaatgtacactttattggt
gcaattggtgatgatcaaattgggaaaacaatgaagcaagcctttgaacaagacgggatc
aatacagaagcaatttctgttattgaaaaccaatcaacagggttagcgatgattcaggtt
gccgatttgggtgaaaacagtattgtgatttccgctggcgcaaatgcggatctttcagaa
gccttagttgaacaacataaatcacatattgaacaagcggatattttgctaatgcagttg
gaaagtccgttacaagcggtggctaaggctgcaaaaattgccaaaaaagcaggggtaaaa
gtggtgttaaatcccgctcccgctcaacctttaccggacagtttattatcacaaattgac
attatcaccccaaatgaaacagaagcggaaatactgactggaattaaagtgaccaatgag
caaactgcagctgtagccgccaaccattttcatcaacttgggatcgaaacggtcttaatt
accctaggctcaaaaggtttgttttatagcgaaaaaggacaaggtgaaattattccaggg
ttccttgtcgatgcagtggatacaacagccgcaggcgatacatttaacggagcttttgtg
acggcattattagaaggaaaatcacctaaagaatctattcgttttgctcacgcagcagcg
gcaatttcggtcacaagaatgggggcacagacagcaattcctagacgcgaggagattgag
gcgctcttactattttcaatgtaa

DBGET integrated database retrieval system