KEGG   Haemophilus parasuis SH0165: HAPS_1747Help
Entry
HAPS_1747         CDS       T00825                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HAPS_1747 (tpiA)
   01230 Biosynthesis of amino acids
    HAPS_1747 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HAPS_1747 (tpiA)
   00051 Fructose and mannose metabolism
    HAPS_1747 (tpiA)
   00562 Inositol phosphate metabolism
    HAPS_1747 (tpiA)
Enzymes [BR:hap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HAPS_1747 (tpiA)
Exosome [BR:hap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HAPS_1747 (tpiA)
  Exosomal proteins of bladder cancer cells
   HAPS_1747 (tpiA)
  Exosomal proteins of melanoma cells
   HAPS_1747 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1720591..1721382)
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELVESLKRELDGVTGCDVAIAPPVMYLAEAEAALASCGC
ECTTKKLIALGAQNVDVNVQGAFTGDISTAMLKDFGAKYIIIGHSERRTYHKESDEFIAK
KFAALKEAGLVPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAEAFNGAVIAYEPVWA
IGTGKSATPAQAQAVHAFIRGHIAKQSQAVADQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAEKAKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccgttagtaatgggtaactggaaattaaacggtagcaaagcattcact
aaagaattagtggaaagcttaaaaagagaacttgatggtgttacaggttgtgatgtcgca
atcgcaccgccagtgatgtatttggcagaagcagaagcggcattggcgagctgtggttgt
gaatgcaccacgaagaaactcattgcattaggcgctcaaaacgttgatgtgaatgtacaa
ggtgcatttacaggtgatatttcaactgcaatgttaaaagatttcggtgcgaaatatatc
attatcggtcactctgagcgtcgtacttaccacaaagagagcgatgaatttattgcgaaa
aaatttgcagcattaaaagaagcaggtttagtgccagtgttatgtatcggtgaaactgaa
gcagaaaatgaagctggtcaaaccgaagcagtatgtgctcgtcaattagatgcagtatta
aatactttaggtgcagaagcattcaatggtgcagtaattgcgtacgaaccagtttgggca
atcggtacaggtaaatctgcaaccccagcacaggcgcaagcagttcacgctttcattcgt
ggtcacattgcaaaacagtcacaagcagtggcagatcaagtgatcattcaatacggcggt
tcagtcaatgatgcgaatgcagcagaattatttactcagccagacattgatggtgcgtta
gtgggcggtgcgtcacttaaagcgcctgcatttgcggtgatcgtaaaagcagcagaaaaa
gcgaaagcgtaa

DBGET integrated database retrieval system