KEGG   Haemophilus parasuis SH0165: HAPS_1826Help
Entry
HAPS_1826         CDS       T00825                                 

Definition
Type III restriction-modification system EcoPI enzyme subunit res
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hap  Haemophilus parasuis SH0165
Brite
Enzymes [BR:hap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HAPS_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1792535..1795450)
Genome map
AA seq 971 aa AA seqDB search
MAGFNFENDLPHQLSAIEDILQMFEYAKISYAQNLETRLKSNPVLELNESQKKRNLAEIQ
TRSSFAKSLNKTGNTLSNIFDIAMETGTGKTYTYTRAMFSLNQSFGVNKFIVLVPTVAIK
AGTKNFLESASARSRFFDDFGKRIELYEVNAKKGNKKDKQQVPENLINFINANDQNSIHI
LLINMGMLNSETMNIAIDQDMFQEAHGSAFEALSAVKPFLIIDEPHRVKTSGKTWQNVLK
LGVQYILRFGATFDGFENLIHTLTSLDAFEQNLVKGVRAFITEFDGVDDMLIKFIGQTES
KSEAVFEITHSHKKTPKRLEIAKNGSLGVIHGEMSHLLLNEFNSSTAVLSNRLALQKGEI
ISPYSFNQSLQEQMLYQAVIRHFDIERTLLTRTPRIKPLSLIFIDDIAGYRDEQGLPDSL
KSRFEAIVINEAQKRLANETNEFYKAYLQKTLADISQTHGGYFSDDNNNKDEYIEKQINE
ILHEKEKLLDLDNPRRFIFSKWTLREGWDNPNVFVICKLRSSGSETSKLQEVGRGLRLPV
NEFMHREKGEQFYLNYFVDFSEKDFVADLIKDIREKSGEKVIIPTKLTDELLAKIMQCYP
NESKRKIINHLADEHIIDDDLNLLGNGWKQLQQAYPKAFEFESSLNNKIQTGIGKKETVL
IRKDKYHALKTLWETLNRRVVLNYQIDNEQSFYSLLKQFFAVEVMGKLDKSYTTMQAQEL
QVNPDEMLIKYGGREKLIENTGYVLSYGEFANELAMSLNVSLKSLHQVLLELNWTEHKHQ
TRHNIRHIHSLFRKWLLQHFLSTQTISYTEVNSQVHPTAFTDEKGNAKDSILSSDIGRLN
ETGIVADNYLFETLFYDSPLEKENILLNLDYVTVFTKIPKNTIAIPVAGGGTYSPDFAYV
LHHKDGTQTLNLVVETKDAYEFDLRTDEKEKIKYAQILFDKLSSDTGIKVEFKTQFKGKH
IERILEELRER
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggctggctttaattttgaaaacgacttaccgcaccaattatccgccatagaagacatt
ttgcaaatgtttgaatacgccaaaatttcttatgctcaaaatttggaaacacgattaaaa
agtaatcctgttttagaattaaacgaatcgcaaaaaaagagaaatttagcagaaattcaa
actcgctcaagtttcgccaaaagcctaaacaaaacaggcaatactttatccaatattttt
gatattgcgatggaaacaggcacgggcaaaacttatacctacacaagggcaatgttttct
ttaaatcaatcttttggggtgaataaatttattgtgcttgtgccaacggttgcgattaaa
gcaggcacaaaaaactttttggagtctgcatccgccagaagtcggttttttgatgatttt
ggcaaacgcattgagctttatgaagtcaatgccaaaaaaggcaataaaaaagacaaacaa
caagtccccgaaaatctcatcaattttatcaatgccaatgaccaaaacagcattcatatt
ttgctgattaatatgggaatgctcaattcagagacgatgaacattgccattgaccaagat
atgtttcaagaggctcacggtagtgcatttgaggcattatcggcggttaagccatttttg
attattgatgaacctcaccgtgtcaaaaccagtggcaaaacttggcaaaatgttttaaaa
ctgggagtccaatatattttgcgatttggggcaacttttgatggctttgaaaatttaatt
catacgctgacttcacttgatgcttttgaacaaaatttggtaaaaggcgtgcgtgcattt
attaccgagtttgacggtgttgatgatatgctcatcaaatttattgggcagactgaaagc
aaaagtgaagcagtttttgaaatcactcacagccataaaaaaaccccaaaacgcttagaa
attgccaaaaatggctcattaggcgttattcatggcgaaatgtcgcatttattattaaat
gaatttaatagcagtacggcggtgctttctaataggctggctttacaaaaaggcgaaatt
atctcaccttattcgtttaatcaatctttgcaagaacaaatgctctatcaagcggtaatt
cgtcattttgatattgaacgcaccctattaaccagaacaccacgtattaaaccactctct
ttgatttttattgatgatattgcaggttatcgtgatgaacaaggattgcccgatagctta
aaatctcgttttgaggcaatcgttatcaatgaagctcaaaaaagattggcaaatgaaact
aatgaattttataaagcctatttgcaaaaaactttggcagatattagtcaaacgcatggc
ggttattttagcgatgacaataacaataaagatgagtatatagaaaaacaaatcaatgaa
atcttacatgaaaaagaaaaactccttgatttggataatccacgccgttttattttttca
aaatggacattgcgtgagggctgggataatcccaatgtatttgtgatttgtaaattgcgt
tccagtggctctgaaaccagtaaattacaagaggtggggcgaggacttcgtttgcctgtc
aatgaatttatgcatcgtgaaaaaggcgagcagttttatttaaattattttgtggatttc
agcgaaaaagattttgtggcggatttgattaaagacattcgtgaaaaatcaggcgaaaaa
gtcattattcctacaaaattgaccgatgaacttcttgccaaaattatgcaatgttatccc
aatgaaagtaaacgcaaaatcatcaatcatttggctgatgagcatattattgatgatgat
ttgaatttattaggaaacggctggaaacaattacaacaggcttatccaaaagcctttgaa
tttgaaagttcattgaataataaaattcaaacaggcattggcaaaaaagaaacggtcttg
attagaaaagacaaataccacgctttaaaaacattgtgggaaactttaaatcgccgtgtg
gtgctaaattatcaaattgataatgaacagagtttttattccttattaaagcagtttttt
gccgtcgaggtgatgggtaaattagacaaaagctataccacaatgcaagcccaagaatta
caagttaatcctgatgaaatgcttatcaaatatggcggacgagaaaagctgatagaaaat
acaggctatgtacttagctatggtgaatttgccaatgaattggcaatgagtttgaatgtt
agtttaaaaagtctacatcaagttttattggaattaaattggacagagcataaacatcaa
actcgccacaatattcggcacattcatagtttgtttagaaaatggttgttgcaacatttt
ttatccacacaaaccattagctataccgaagttaatagccaagttcacccaacggcattt
actgatgaaaaaggcaatgccaaagacagcatattgtcatcagatattgggcgtttgaat
gaaactggtatcgtagcggacaattatttgtttgaaacgctgttttatgattcgcccctt
gaaaaagaaaatattctattaaatttggattatgttaccgtttttaccaaaattcccaaa
aataccattgccattcctgtggcgggaggtgggacttattcgcctgattttgcctatgtg
cttcatcacaaagacggcactcaaaccttaaatctcgtggtagaaaccaaagacgcttat
gaatttgatttacgtactgatgaaaaagaaaaaatcaaatacgcacaaatcttatttgat
aaattaagtagcgatactggcattaaagtagaatttaaaacgcaatttaagggtaagcat
attgagcggattctcgaagaattgagagagcggtaa

DBGET integrated database retrieval system