KEGG   Haemophilus parasuis SH0165: HAPS_1992Help
Entry
HAPS_1992         CDS       T00825                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAPS_1992 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAPS_1992 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HAPS_1992 (trpA)
Enzymes [BR:hap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HAPS_1992 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1954871..1955695)
Genome map
AA seq 274 aa AA seqDB search
MIVQSSRFSRLFAQLADKKQGGFVPFVTLCDPDFERSFEIICTLVDNGADALELGFPFSD
PLLDGPVIQAANDRALNAGCSTEESFQLLAKVRSTYPDIPISLLLCANLIYAQTLDKFYA
RCAEVGVDAVLVADIPLLAAEEYIQAAQRHDVQPVFICPPNANESTIKAVAQHTRGYTYL
VSRAGVTSAENQTQAANLDVLIEGLTQYQSAPILQGFGIAKPEQVKEALRLGAAGAISGS
ATVQIIERNLDNHPQCLLELAQFVQNMKRATHLS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgcaatcatctcgtttcagccgtttatttgctcaattagctgataaaaaacaa
gggggatttgttccttttgtgacactttgtgaccctgattttgagcgctcttttgagatt
atttgtactttagttgataatggtgcggatgccttagaattaggctttcccttttctgat
cccttgttggacggaccggttattcaggctgccaatgatcgggctctcaatgcaggttgt
agcaccgaagaaagttttcagttacttgccaaagtgcggtcaacctatccagacataccg
attagtctgttgctttgtgccaatttaatttatgcgcaaactcttgataaattctatgca
cgctgtgccgaagtgggcgttgatgccgtattggttgcagatattcctttactcgccgca
gaagaatatatccaagctgctcaacgtcatgatgtacagccggttttcatttgtccacct
aatgctaatgaatccacaattaaagcggtagctcaacatactcgaggttatacttattta
gtctcaagagccggcgttactagcgcagaaaatcaaacacaagctgccaatttagatgtt
cttattgaagggttaacccaatatcaaagcgccccaattttacaaggttttggtatcgca
aaaccggaacaagttaaagaggcgctgcgtttaggggctgccggtgcaatctcgggttcc
gctacagttcagattattgaacgaaacctcgacaatcaccctcaatgtttgcttgaattg
gcacaattcgtacaaaacatgaagagggcaacacatctctcataa

DBGET integrated database retrieval system