KEGG   Haemophilus parasuis SH0165: HAPS_1993Help
Entry
HAPS_1993         CDS       T00825                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAPS_1993 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAPS_1993 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HAPS_1993 (trpB)
Enzymes [BR:hap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HAPS_1993 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1955692..1956888)
Genome map
AA seq 398 aa AA seqDB search
MTTILNPYFGEFGGMFVPEILVPVLQELEKAFVEAKEDPAFQQEFQDLLKNYAGRPTALT
CCRNLTKGTNTTLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVATA
LACAMLNIPCRIYMGAKDVERQSPNVFRMKLMGAEVIPVQKGSCSLKDACCEAMRDWAAN
YATTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEKEGRLPDAVIAAVGGGSNAIGM
FADFIEEKSVRLIGIEPAGKGIETGEHGAPLRHGSVGIYFGMRSPIMQTKDGQIEESYSI
SAGLDFPSVGPQHAHLHAIGRADYESITDDEALEAFQALAQHEGIIPALESSHALAYALK
LIKQDPTKTQLLVVNLSGRGDKDIFTVDKILTAKGAIK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattcttaatccctatttcggtgagttcggcggtatgttcgttcccgaaatc
ttagtacctgttttacaagaactggaaaaagcctttgtggaggcgaaagaagatcctgct
ttccaacaagaatttcaggatttattaaaaaattacgccggtcgccctacagcattaaca
tgttgccgtaatttaacaaaaggcacgaacactacactttatttaaaacgtgaggattta
ttgcatggtggcgcccataaaaccaaccaagttttagggcaaattctcttagcaaaacgc
atggggaaaacacgtattattgctgaaaccggtgcaggacaacatggcgttgcgactgca
ttagcctgtgcaatgctcaatataccttgccgtatttatatgggcgcaaaagatgttgaa
cgtcaatcgcctaatgttttccgaatgaagttaatgggcgccgaagtgatccctgtacaa
aaaggctcttgttcactcaaagatgcttgctgtgaggctatgcgggattgggctgcaaat
tatgccacaacacattatctgctcggtaccgccgcaggcccgcacccatttccaaccatc
gtgcgtgaattccaaaaaatgattggagaagaaaccaaaaggcaaattttggagaaggaa
gggcgcttacctgatgcggttattgcggctgtcggcggcggatcaaatgccattggtatg
tttgccgattttattgaagaaaaaagtgtacgcctaattgggattgaaccagcaggcaaa
ggcattgaaaccggtgagcatggtgcgcctttacgtcatggttcagtcggtatttatttt
gggatgagatccccgattatgcaaaccaaagacgggcaaattgaagagtcttatagtatt
tcagccggtttagacttcccttctgtcggcccgcagcacgcgcatctccatgctattggt
cgtgcagattatgagagcattacagatgatgaagcacttgaggcatttcaagctttagca
caacatgaaggtattattcctgctttagaaagctcccatgctttggcttacgcattaaaa
ctcatcaagcaagatccaacaaaaacacaactacttgttgtgaatctatccggtcgtggt
gataaggatattttcacggtggataaaattttaactgcaaaaggagctatcaaatga

DBGET integrated database retrieval system