KEGG   Glaesserella parasuis SH0165: HAPS_1994Help
Entry
HAPS_1994         CDS       T00825                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hap  Glaesserella parasuis SH0165
Pathway
hap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hap01100  Metabolic pathways
hap01110  Biosynthesis of secondary metabolites
hap01130  Biosynthesis of antibiotics
hap01230  Biosynthesis of amino acids
Module
hap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HAPS_1994 (trpC)
Enzymes [BR:hap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HAPS_1994 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HAPS_1994 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ACL33466
UniProt: B8F814
Position
complement(1956908..1958377)
Genome map
AA seq 489 aa AA seqDB search
MPQNHTQPSILKTIVQDKLLWIQHQQTHFPLSAFQNSLQPSDRDFYTALQQGSAQKPAYI
LECKKASPSKGLIRANFNVEDIAQVYKSYASAISVLTDEKYFQGDFTYIPRVRQLVNQPI
LCKDFIVSEYQIYLARYYQADAILLMLSVLDDETYRRLAEIAHGLGMGILTETSNQTELT
RAIELGAKVIGINNRDLHDLSVDIARTPPLARQIPAGRIIISESGIYHHHQIQQLKSDVH
GFLIGSSLMGSPDLHQSVRTLIFGENKVCGLTRPQDVQAVYEQGALYGGLIFAEHSPRQL
SLRQAQELVVQAPLRFVGVFQNQSIDFIEKIVNQLDLFAVQLHGEETAEFIAALRQQLPQ
SCQIWKAISVDAPSKITLAALATKTQSKSAVKIPSIPHVDRYILDSKIGNQRGGTGQPFD
WSKIPQEYKSKLLLAGGINPDNIELALSQHCLGLDLNSGVESLTGMKSPQKLAAVFNKIL
ERQTPKKLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaaccacacgcaacctagtattttgaaaacaatcgtacaggataaattactt
tggatccaacaccaacaaacccattttcctttgagtgcgtttcaaaatagccttcaacct
agtgatcgggatttttataccgcacttcagcaaggttcggcgcaaaaaccggcttatatt
cttgaatgtaaaaaagcctctccctcaaaaggtttgattcgagccaattttaatgtagaa
gatattgcacaggtgtataaaagttatgcctccgcaatttctgttctcacagatgaaaaa
tattttcaaggggatttcacttatattccgcgcgttcgccagctcgtcaaccaaccaatc
ttgtgcaaagattttattgtgagcgaatatcaaatttatttggcgcgctattatcaagca
gatgcgattttattaatgctttctgtgttagatgatgagacctatcgtcgattggcagaa
attgcacatggattaggcatgggaatattaacggaaacttcaaatcaaacagaattaact
cgagccattgagcttggcgctaaagttattggtatcaataatcgtgatttgcatgattta
tctgtcgatattgctcgtacaccgcctcttgcacgccaaattccggcaggccgaattatt
attagcgaatcaggcatttaccaccatcatcaaattcaacagctgaaatctgatgtacat
ggttttcttattggtagcagtttgatgggaagtcccgatctccatcaaagcgtccgcacc
ttaatttttggcgaaaataaagtttgtggacttactcgtccgcaggatgtacaagccgtg
tatgagcaaggcgcattgtatggaggcttaatttttgcagaacattctccccgacagctt
tcattacgccaagctcaagagttggtggtacaggctcccttgcgttttgtcggcgtattt
caaaatcaatctattgattttattgaaaaaatcgtcaaccaacttgatttatttgcagta
caattacatggcgaagaaacggctgaatttattgccgcacttcgccaacaattaccgcaa
tcatgccaaatttggaaagcaatttcagttgatgcgccctctaaaattacattagccgcc
cttgcaaccaaaacacaaagtaaaagtgcggtaaaaattccgtcgattccccatgtggat
cgctacatattggacagcaaaatcggcaatcaacgtggagggactggacagccttttgat
tggtcgaaaatccctcaagaatataaatctaaactgctccttgccggtggcattaatcca
gacaatattgagcttgccttatcacaacattgcctaggtcttgatctcaattccggcgta
gaaagtctaacgggcatgaaaagcccacaaaaattagcagcggtgtttaacaaaattttg
gagcgtcaaacacctaaaaaattatcataa

DBGET integrated database retrieval system