KEGG   Haemophilus parasuis SH0165: HAPS_2031Help
Entry
HAPS_2031         CDS       T00825                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HAPS_2031 (holD)
   00240 Pyrimidine metabolism
    HAPS_2031 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HAPS_2031 (holD)
   03430 Mismatch repair
    HAPS_2031 (holD)
   03440 Homologous recombination
    HAPS_2031 (holD)
Enzymes [BR:hap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HAPS_2031 (holD)
DNA replication proteins [BR:hap03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HAPS_2031 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1995950..1996363
Genome map
AA seq 137 aa AA seqDB search
MNRRDLLLTEMNIPQWILVKPQVLKGDAQIRLADNIKLVVICEEDHQQTGLFQDVLRALQ
LNHEQYQWISLEQAMRLQFDHQLIFWLIQPEEQAVQFTKKFANQTAWQCESWQMLSQATQ
KRELWQQMQLFCKDMAE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccgagatctgcttctaacagaaatgaatataccccaatggatacttgttaaa
ccgcaagtactcaaaggcgatgcacaaattcgcttggcggacaatataaagctggtagtt
atttgcgaagaagatcaccaacagactgggttatttcaagatgttttacgagccttgcaa
ttaaatcacgagcaatatcaatggattagccttgagcaagcaatgcgtctgcaattcgat
catcaactgattttctggctgattcaacctgaagaacaagcggtacaatttacaaaaaaa
tttgcaaatcagaccgcttggcagtgtgagtcttggcaaatgctttcccaagctacacaa
aagcgagagctttggcaacagatgcaactgttttgtaaagatatggcagaataa

DBGET integrated database retrieval system