KEGG   Haemophilus parasuis SH0165: HAPS_2031Help
Entry
HAPS_2031         CDS       T00825                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hap00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hap00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hap03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hap03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hap03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1995950..1996363
Genome map
AA seq 137 aa AA seqDB search
MNRRDLLLTEMNIPQWILVKPQVLKGDAQIRLADNIKLVVICEEDHQQTGLFQDVLRALQ
LNHEQYQWISLEQAMRLQFDHQLIFWLIQPEEQAVQFTKKFANQTAWQCESWQMLSQATQ
KRELWQQMQLFCKDMAE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgccgagatctgcttctaacagaaatgaatataccccaatggatacttgttaaa
ccgcaagtactcaaaggcgatgcacaaattcgcttggcggacaatataaagctggtagtt
atttgcgaagaagatcaccaacagactgggttatttcaagatgttttacgagccttgcaa
ttaaatcacgagcaatatcaatggattagccttgagcaagcaatgcgtctgcaattcgat
catcaactgattttctggctgattcaacctgaagaacaagcggtacaatttacaaaaaaa
tttgcaaatcagaccgcttggcagtgtgagtcttggcaaatgctttcccaagctacacaa
aagcgagagctttggcaacagatgcaactgttttgtaaagatatggcagaataa

DBGET integrated database retrieval system