KEGG   Haemophilus parasuis SH0165: HAPS_2081Help
Entry
HAPS_2081         CDS       T00825                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HAPS_2081 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HAPS_2081 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HAPS_2081 (thrC)
Enzymes [BR:hap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HAPS_2081 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2041403..2042677)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKHPEEQVNFAQGVRQGLGKDQGLFFPEVLPKFDDIDALLALPLVERSQKILSAL
IGDELPQETLNAMVKNAFTFPAPLAKVNNDIYALELFHGPTLAFKDFGGRFMAQALSAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
ESDFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRSDVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLKSGKWEPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWSLSELGSDALNDAETEEALKAQYAEGYLCEPHGAIAYQVLK
DQLQVGETGIFLCTAHPAKFKESVERILDIELPLPEALDKHNKMELLSDTMAADFAKLRE
YLLK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacctatacaacatcaaacaccctgaagaacaagtgaattttgcccaaggcgttcgc
caagggttaggcaaagatcagggcttatttttccctgaagtgttacctaaatttgacgac
attgacgctttattagcattaccgttggttgagcgtagccaaaagattttatcagcattg
attggcgatgaattaccacaagaaaccttaaatgcaatggtgaaaaatgcgtttactttc
cctgcaccactagcaaaagtgaataatgatatttatgcgttagagttattccacggtccg
acccttgcctttaaagactttggcggtcgctttatggcacaagcgttaagtgcggtgcgt
ggcgatggcaaaattacgattttaacagcaacatcaggtgacacaggtgcggcagtggct
cacgctttctacggtttagaaaatatcaatgtggttattctttatccgaaaggtaaaatc
agtccattacaagaaaaattattctgtaccttaggcggtaacattcgtaccgtggcgatt
gaatctgactttgatgcttgccaagcgttagttaaacaagcctttgatgatgcggaactt
cgtcaagctatcggcttaaactcagcaaactctatcaatatcagtcgtttactcgctcaa
gtttgttactactttgaagcggtggctcaattgccgaaagagaaacgtagcgatgtggtg
gtttctgtaccaagcggtaactttggtaacttaactgcaggcttaattgccaaaacctta
ggcttaccgattaagcgttttatcgcttcaaccaatgcgaacgacaccgtgccacgttat
cttaaatcgggcaaatgggaaccgaatgcaacggttgcgacattatcaaatgcaatggat
gttagccgtccgaacaactggccacgtgttgaagagctgtttaaacgtaatggttggagc
ttgagcgagttaggttcagatgccttaaatgatgcagaaaccgaagaagcattaaaagca
caatatgcggaaggctatttatgtgaaccgcacggggcaattgcttaccaagtattgaaa
gatcagctacaagtaggcgaaacaggtattttcctttgcaccgcacaccctgcgaaattt
aaagagagcgtagaacgtattttagatattgaactgccgttgcctgaagcgttagacaaa
cataacaaaatggaactgttgtcggatacaatggcggcagattttgcgaagttaagagag
tatcttttaaaatag

DBGET integrated database retrieval system