KEGG   Haemophilus parasuis SH0165: HAPS_2178Help
Entry
HAPS_2178         CDS       T00825                                 

Gene name
recD
Definition
ATP-dependent exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hap  Haemophilus parasuis SH0165
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HAPS_2178 (recD)
Enzymes [BR:hap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HAPS_2178 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2138151..2140043)
Genome map
AA seq 630 aa AA seqDB search
MIDQKQQAYNYTVQQQNVAIFLSALVSFNVMQGHSCVRLNSDLTTHFFDLQKKHFSRDFH
TEILQKIEGISPLEWQSLLHNHIAFSQDPTQVAPLLFQQDRLYFYRYWQAEYRVARYLQQ
AVSSDLKKADIDLHRQILQRFFPKQADTDWQKIAVATALTKRFCLISGGPGTGKTRTVAI
LLAALQLKQLEQNQPLLKIALAAPTGKAAARLKESISNNLASLDLPDSLKAEVPTRASTI
HSLIGINPHSDLPRHHAQNPLHLDLLVVDEASMIDLFILEKLLNALKPDTRLIMLGDKDQ
LASVEAGNLMGELGSLIRFGYSNEHSDYLTDVTEHQIYPTVENVPAICNSLCHLRRSFRF
DENSGIGQLAKQVNTQQAVKSWQILTNRAYDDLTLACYPKVTDFPEKSQWIQHCVNSVVE
KAVELYSDYLNKVKARVLSPEAVSIGEIFKAFQQVRFLSALRVSELGVERLNQTIAEALL
QARLLHFKHSRDSYIGKPILITENAPQLHIFSGDIGLILPDEAGRLRVYFETEQNGKHLD
ISLSRLPSYEPAYVMTVHKSQGSEFDHTLLVMPLSHSPVLTKELIYTAITRAKKQFTLFS
EEKIWKQAVKAKIQRQSGLKEQILADILMK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcagaaacagcaggcttataactatacggttcaacaacagaatgtagcaatc
tttctaagtgcattagtttcttttaatgttatgcaaggacatagttgtgttcgtttaaat
tctgatttaacaacccacttttttgacttgcaaaaaaagcatttcagccgtgattttcat
acggagattttgcaaaaaattgaggggatttcaccgctagagtggcagtcgttgctacat
aaccatattgcttttagccaagatcctacacaggttgcacctttattatttcaacaggat
cgcctatatttttatcgttattggcaggcagagtatcgtgtagcacgttatttacaacaa
gcggtaagttcggatttaaaaaaagcagatatcgatcttcatcgtcaaattttacaacgc
ttttttccaaaacaagctgatacggattggcaaaaaattgcggttgcaacagcattaact
aaacgattctgtctgatttcaggcgggcctggcacaggcaaaacccgaacagttgctatt
ttacttgcagcattacagcttaaacaattagaacagaaccaaccgcttttaaagattgcc
cttgctgctccgacaggaaaagctgcggctcgtttaaaagaatctatttcaaataatctc
gctagtcttgatcttcctgacagtttgaaagcagaagtaccaaccagagcctcaacaatc
cattcgttaatcggcattaatccccatagtgatctacctcgtcatcacgctcaaaatcca
ctgcatttagatctgttagtcgtggacgaagcgtcaatgatcgatctcttcatactggaa
aaactgttgaatgccttaaaaccagatacccgtttgattatgcttggggataaagatcaa
cttgcttctgtagaagctggaaatttaatgggggagttgggtagtttgatcagatttggt
tatagcaatgagcatagtgactatctaactgatgtaacagaacatcaaatttatcctaca
gtggaaaatgtccccgcaatttgtaattcattatgtcatcttcgtcgaagttttcgtttt
gacgaaaattcagggattgggcagttagctaaacaagtgaacacccaacaagcggtgaaa
tcgtggcagattttaacgaatagggcttatgatgatttaacattagcgtgttaccctaaa
gtcacggattttcctgaaaaatcacaatggatacaacactgtgtaaatagcgtggtagaa
aaagcggtggagttatattccgattacttgaacaaagtgaaagctcgagtactttcccca
gaagccgtgtctatcggtgagatatttaaagcattccaacaagtacgctttttgtcagcc
ttacgcgtcagtgagttgggcgtagaacggcttaatcaaaccattgcagaagcattattg
caagcacgtctattgcattttaaacatagccgagacagctacattggcaagccgattttg
attaccgaaaatgcccctcaacttcatatctttagtggtgatattggcttaattcttcca
gatgaagcaggaagattaagagtatattttgaaacagaacaaaatggaaaacatttagac
atttcccttagtcgtttgccaagttatgaacccgcctatgtaatgaccgtgcataaatca
caaggttctgaatttgatcatactttattggtaatgccactttctcattcgccagtatta
acaaaagagctgatttatacggcgattacccgtgctaaaaaacagtttaccttgtttagt
gaagaaaaaatttggaaacaagcagtaaaagcaaaaattcaacgacaaagtggattaaaa
gaacaaatattggcagatattttaatgaaatga

DBGET integrated database retrieval system